![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Jcr4S16816.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 76aa MW: 8671.62 Da PI: 4.4885 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 87.9 | 1.3e-27 | 12 | 70 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+y++++d+++++++sws+n nsfvv++ ef+k++LpkyFkhsnf+SFvRQLn+Y
Jcr4S16816.10 12 FLSKTYDMVDDPSTNSVVSWSSNDNSFVVWNVPEFQKELLPKYFKHSNFSSFVRQLNTY 70
9*********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 4.4E-29 | 4 | 70 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 5.2E-21 | 8 | 73 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 5.44E-25 | 10 | 70 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 3.9E-23 | 12 | 70 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.2E-16 | 12 | 35 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.2E-16 | 50 | 62 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.2E-16 | 63 | 75 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
MESVTSNSVP PFLSKTYDMV DDPSTNSVVS WSSNDNSFVV WNVPEFQKEL LPKYFKHSNF 60 SSFVRQLNTY VGDVLS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 8e-20 | 3 | 70 | 20 | 87 | Heat shock factor protein 1 |
| 5d5v_B | 8e-20 | 3 | 70 | 20 | 87 | Heat shock factor protein 1 |
| 5d5v_D | 8e-20 | 3 | 70 | 20 | 87 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012070226.1 | 3e-41 | heat stress transcription factor A-1b | ||||
| Refseq | XP_020534386.1 | 3e-41 | heat stress transcription factor A-1b | ||||
| Swissprot | Q9SCW5 | 8e-32 | HFA1E_ARATH; Heat stress transcription factor A-1e | ||||
| TrEMBL | A0A067L5Z1 | 6e-40 | A0A067L5Z1_JATCU; Uncharacterized protein | ||||
| STRING | cassava4.1_031943m | 1e-40 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G16820.2 | 1e-21 | heat shock factor 3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




