PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KDD74600.1
Organism
Helicosporidium
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales
Family MYB
Protein Properties Length: 144aa    MW: 16159.5 Da    PI: 10.5469
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KDD74600.1genomeUBCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.7e-13847847
                     HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     Ed +l+++v+ +G+ +W++Ia+ +g gR +k+c++rw++ 
       KDD74600.1  8 EDVKLIQLVETYGPQNWSLIAKSLGSGRNGKSCRLRWFNQ 47
                     899**********************************996 PP
2Myb_DNA-binding507.1e-165498147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     + ++++eE+e+++  ++qlG++ W++I+++++ gRt++ +k++w+ +
       KDD74600.1 54 KEPFSAEEEEIIIYRHAQLGNK-WAAISKYLP-GRTDNAIKNYWNGH 98
                     679*******************.*********.***********976 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.83148IPR017930Myb domain
SMARTSM007172.6E-6450IPR001005SANT/Myb domain
SuperFamilySSF466894.97E-27795IPR009057Homeodomain-like
PfamPF139214.9E-14863No hitNo description
CDDcd001676.21E-10846No hitNo description
Gene3DG3DSA:1.10.10.602.5E-22855IPR009057Homeodomain-like
PROSITE profilePS5129423.89549103IPR017930Myb domain
SMARTSM007174.7E-1553101IPR001005SANT/Myb domain
CDDcd001672.00E-115699No hitNo description
Gene3DG3DSA:1.10.10.605.5E-2456103IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000031Biological Processregulation of salicylic acid mediated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MLVVRSPEDV KLIQLVETYG PQNWSLIAKS LGSGRNGKSC RLRWFNQLDP NLRKEPFSAE  60
EEEIIIYRHA QLGNKWAAIS KYLPGRTDNA IKNYWNGHLK KRLHSRASEL AASKKLRALA  120
GAALEETLLG EAHASPSPLA SRSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-3221031105C-Myb DNA-Binding Domain
1msf_C1e-3221031105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202, ECO:0000269|PubMed:23603962, ECO:0000269|PubMed:24894996, ECO:0000269|PubMed:9678577}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00596DAPTransfer from AT5G67300Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011398188.19e-55Transcription factor LAF1
SwissprotQ9FDW11e-34MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A059LKF61e-100A0A059LKF6_9CHLO; Uncharacterized protein (Fragment)
STRINGA0A087SHU24e-54(Auxenochlorella protothecoides)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-36myb domain protein r1
Publications ? help Back to Top
  1. Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y
    Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance.
    Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62
    [PMID:24275141]
  2. Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ
    Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence.
    BMC Plant Biol., 2013. 13: p. 192
    [PMID:24286353]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Li D, et al.
    Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44.
    Int J Mol Sci, 2014. 15(5): p. 8473-90
    [PMID:24828206]
  5. Xu DB, et al.
    A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis.
    PLoS ONE, 2015. 10(1): p. e0116385
    [PMID:25635681]
  6. Hieno A, et al.
    Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis.
    Microbes Environ., 2016. 31(2): p. 154-9
    [PMID:27301421]
  7. Zhao Q, et al.
    AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana.
    Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785
    [PMID:27604593]
  8. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]
  9. Nguyen NH,Cheong JJ
    H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress.
    Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043
    [PMID:29649476]
  10. Nguyen NH,Cheong JJ
    AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription.
    Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442
    [PMID:30448055]