PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KFK25103.1

Organism

Arabis alpina

Taxonomic ID

50452

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis

Family

WRKY

Protein Properties

Length: 93aa MW: 10921.3 Da PI: 9.1229

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KFK25103.1	genome	MPIPBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	98	5.9e-31	18	76	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ++Dgy+WrKYGq +v+g+++prsYY+Ct++gC+v+k+ver+ +d k v++tYeg+H+h+ KFK25103.1 18 VEDGYRWRKYGQEVVEGNPYPRSYYKCTYRGCCVRKHVERAFQDSKSVITTYEGKHKHQ 76 58********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.0E-33	4	78	IPR003657	WRKY domain
SuperFamily	SSF118290	3.53E-28	10	78	IPR003657	WRKY domain
PROSITE profile	PS50811	34.28	13	78	IPR003657	WRKY domain
SMART	SM00774	8.4E-31	18	77	IPR003657	WRKY domain
Pfam	PF03106	5.5E-24	19	76	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 93 aa Download sequence Send to blast
MDNQRTVVVQ TTSDIDIVED GYRWRKYGQE VVEGNPYPRS YYKCTYRGCC VRKHVERAFQ 60 DSKSVITTYE GKHKHQIPTP RKSMINTFAD LSL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	4e-36	9	79	8	78	Probable WRKY transcription factor 4
2lex_A	4e-36	9	79	8	78	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Functions with WRKY25 and WRKY33 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). {ECO:0000250\|UniProtKB:Q9SI37, ECO:0000269\|PubMed:21336597}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KFK25103.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salicylic acid (PubMed:11449049). Induced by heat stress (PubMed:21336597). {ECO:0000269\|PubMed:11449049, ECO:0000269\|PubMed:21336597}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006288236.1	8e-45	probable WRKY transcription factor 26
Refseq	XP_010491311.1	3e-45	PREDICTED: probable WRKY transcription factor 26 isoform X2
Swissprot	Q9C5T3	4e-44	WRK26_ARATH; Probable WRKY transcription factor 26
TrEMBL	A0A087G5F1	5e-64	A0A087G5F1_ARAAL; Uncharacterized protein
STRING	A0A087G5F1	8e-65	(Arabis alpina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM509	28	154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G07100.2	8e-47	WRKY DNA-binding protein 26

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]