![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KFK27856.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 143aa MW: 16701.3 Da PI: 10.1692 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 99 | 1.9e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fss+gkl+eys+
KFK27856.1 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYST 59
79***********************************************96 PP
| |||||||
| 2 | K-box | 73.8 | 4.8e-25 | 77 | 143 | 3 | 69 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69
+++ + e +++e++ e+akLk+++e L++++R+++GedL+sLslkeLq+Le+qL+ ++k+iRs+K
KFK27856.1 77 DKQLVGREISQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKELQSLEHQLDAAIKSIRSRK 143
566677888999******************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 8.5E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 32.688 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.03E-39 | 2 | 79 | No hit | No description |
| SuperFamily | SSF55455 | 5.36E-34 | 2 | 91 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.4E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.3E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.4E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.4E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 9.1E-20 | 84 | 143 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 12.203 | 88 | 143 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
| GO:0010154 | Biological Process | fruit development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 143 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFSS KGKLFEYSTD 60 SCMERILERY DRYLYSDKQL VGREISQSEN WVLEHAKLKA RVEVLEKNKR NFMGEDLDSL 120 SLKELQSLEH QLDAAIKSIR SRK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 4e-23 | 1 | 73 | 1 | 72 | MEF2C |
| 5f28_B | 4e-23 | 1 | 73 | 1 | 72 | MEF2C |
| 5f28_C | 4e-23 | 1 | 73 | 1 | 72 | MEF2C |
| 5f28_D | 4e-23 | 1 | 73 | 1 | 72 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1 and CAULIFLOWER. Is required subsequently for the transition of an inflorescence meristem into a floral meristem (PubMed:28586421). Seems to be partially redundant to the function of APETALA1 and CAULIFLOWER in the up-regulation of LEAFY. Is also required for normal pattern of cell division, expansion and differentiation during morphogenesis of the silique (PubMed:28586421). Probably not required for fruit elongation but instead is required to prevent ectopic activity of IND. Represses SAUR10 expression in stems and inflorescence branches (PubMed:28586421). {ECO:0000269|PubMed:10648231, ECO:0000269|PubMed:15035986, ECO:0000269|PubMed:28586421, ECO:0000269|PubMed:9502732}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KFK27856.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Dramatically up-regulated upon the transition from vegetative to reproductive development. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF386929 | 0.0 | AF386929.1 Arabidopsis thaliana floral homeotic protein AGL8 (MSL3.3) mRNA, complete cds. | |||
| GenBank | ATU33473 | 0.0 | U33473.1 Arabidopsis thaliana agamous-like 8 (AGL8) mRNA, complete cds. | |||
| GenBank | AY072463 | 0.0 | AY072463.1 Arabidopsis thaliana floral homeotic protein AGL8 (MSL3.3) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010456827.1 | 6e-99 | PREDICTED: agamous-like MADS-box protein AGL8 | ||||
| Refseq | XP_010483747.1 | 6e-99 | PREDICTED: agamous-like MADS-box protein AGL8 | ||||
| Swissprot | Q38876 | 3e-99 | AGL8_ARATH; Agamous-like MADS-box protein AGL8 | ||||
| TrEMBL | A0A087GDA4 | 7e-98 | A0A087GDA4_ARAAL; Uncharacterized protein (Fragment) | ||||
| TrEMBL | A0A178UPQ6 | 2e-97 | A0A178UPQ6_ARATH; FUL | ||||
| TrEMBL | R0EYA7 | 3e-97 | R0EYA7_9BRAS; Uncharacterized protein | ||||
| STRING | A0A087GDA4 | 1e-98 | (Arabis alpina) | ||||
| STRING | XP_010456827.1 | 2e-98 | (Camelina sativa) | ||||
| STRING | XP_010483747.1 | 2e-98 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM792 | 25 | 110 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G60910.1 | 1e-101 | AGAMOUS-like 8 | ||||




