PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KFK33763.1

Organism

Arabis alpina

Taxonomic ID

50452

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis

Family

ZF-HD

Protein Properties

Length: 101aa MW: 10774.1 Da PI: 8.2928

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KFK33763.1	genome	MPIPBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	106.8	1.3e-33	30	87	3	60
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAa++Gg+avDGC+Efm+s+geegt+ al+CaACgCHR+FHRre ++e KFK33763.1 30 GVRYGECQKNHAAAVGGYAVDGCREFMASSGEEGTVVALTCAACGCHRSFHRREIQTE 87 79****************************************************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	2.0E-34	1	96	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	3.4E-29	31	84	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.2E-28	32	84	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	24.976	33	83	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 101 aa Download sequence Send to blast
MRKRQVVLRR ASPEEPSRSS STASSLTVRG VRYGECQKNH AAAVGGYAVD GCREFMASSG 60 EEGTVVALTC AACGCHRSFH RREIQTEVVC DCNSPPPSAG N

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KFK33763.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU953330	1e-95	EU953330.1 Zea mays clone 1399539 zinc finger homeodomain protein 1 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018481496.1	4e-58	PREDICTED: mini zinc finger protein 2-like
Refseq	XP_018481497.1	4e-58	PREDICTED: mini zinc finger protein 2-like
Swissprot	Q9LJW5	5e-52	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A087GV61	3e-67	A0A087GV61_ARAAL; Uncharacterized protein
STRING	A0A087GV61	5e-68	(Arabis alpina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM944	28	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	2e-47	mini zinc finger 2

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]