![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KFK42528.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 84aa MW: 9923.21 Da PI: 6.519 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 32.6 | 1.8e-10 | 35 | 73 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
+T+eEd+l+ + k+ G + W++Ia +++ gRt++++ +w
KFK42528.1 35 MTQEEDDLISRMYKLVGER-WDLIAGRIP-GRTPEEIERFW 73
7******************.*********.*********99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 4.0E-8 | 31 | 79 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 8.02E-8 | 34 | 73 | No hit | No description |
| Pfam | PF00249 | 3.6E-9 | 35 | 74 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS50090 | 6.737 | 36 | 73 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 8.6E-12 | 36 | 74 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 2.03E-8 | 36 | 76 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0080147 | Biological Process | root hair cell development | ||||
| GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
MDKQRKSKHP KTTHTTIVAS SSEEVSSLEW EEIAMTQEED DLISRMYKLV GERWDLIAGR 60 IPGRTPEEIE RFWVMKNHRT SQLH |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KFK42528.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY519518 | 8e-87 | AY519518.1 Arabidopsis thaliana MYB transcription factor (At1g01380) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023632735.1 | 9e-46 | MYB-like transcription factor ETC1 isoform X2 | ||||
| Swissprot | Q9LNI5 | 3e-34 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
| TrEMBL | A0A087HK76 | 1e-54 | A0A087HK76_ARAAL; Uncharacterized protein | ||||
| STRING | A0A087HK76 | 2e-55 | (Arabis alpina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G01380.1 | 5e-36 | MYB_related family protein | ||||




