![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KFK43105.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 123aa MW: 14633.7 Da PI: 5.2567 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 36.5 | 1.1e-11 | 14 | 58 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
g W Ede+l av ++G ++W++I++ + ++++kqc +rw+ +
KFK43105.1 14 GVWKNTEDEILNVAVMKYGLNQWDRISSLLV-RKSPKQCEDRWYEW 58
68*****************************.***********987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 2.42E-12 | 8 | 58 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 10.537 | 8 | 63 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-12 | 10 | 58 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 6.2E-10 | 12 | 61 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.4E-10 | 14 | 58 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.90E-9 | 16 | 58 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 3.8E-7 | 60 | 100 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 3.73E-9 | 61 | 104 | IPR009057 | Homeodomain-like |
| CDD | cd11659 | 2.80E-20 | 61 | 102 | No hit | No description |
| Pfam | PF13921 | 1.8E-8 | 62 | 105 | No hit | No description |
| SMART | SM00717 | 0.031 | 62 | 105 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS50090 | 6.829 | 62 | 103 | IPR017877 | Myb-like domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 123 aa Download sequence Send to blast |
MTMTMTMTIK MNQGVWKNTE DEILNVAVMK YGLNQWDRIS SLLVRKSPKQ CEDRWYEWQA 60 EWSREEDEKL MHIAKLMPNQ WRSIALIVGF SPTQCFERYE FLRSKENYQA ADDPNPESKA 120 CTS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5mqf_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
| 5xjc_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
| 5yzg_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
| 5z56_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
| 5z57_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
| 5z58_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
| 6ff4_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
| 6ff7_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
| 6icz_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
| 6id0_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
| 6id1_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
| 6qdv_O | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KFK43105.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC254583 | 4e-34 | AC254583.1 Capsella rubella clone JGIBSIA-25G5, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_005851759.1 | 1e-47 | hypothetical protein CHLNCDRAFT_33512, partial | ||||
| Refseq | XP_010528754.1 | 3e-46 | PREDICTED: cell division cycle 5-like protein | ||||
| Swissprot | P92948 | 2e-46 | CDC5L_ARATH; Cell division cycle 5-like protein | ||||
| TrEMBL | A0A087HLV3 | 8e-88 | A0A087HLV3_ARAAL; Uncharacterized protein | ||||
| STRING | A0A087HLV3 | 1e-88 | (Arabis alpina) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09770.1 | 6e-48 | cell division cycle 5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




