PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN01010.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

NF-YB

Protein Properties

Length: 171aa MW: 18652.9 Da PI: 6.1145

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN01010.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	177.1	1.6e-55	26	119	2	95
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 reqdr+lPian+srimkk+lP n+ki+kdak+t+qecvsefisf+tseas+kcq+ekrktingddllwa+atlGfedy+eplkvyl++yre ++ KHN01010.1 26 REQDRYLPIANISRIMKKALPPNGKIAKDAKDTMQECVSEFISFITSEASEKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLARYREGDT 119 89****************************************************************************************9665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.7E-53	21	125	IPR009072	Histone-fold
SuperFamily	SSF47113	5.12E-40	28	127	IPR009072	Histone-fold
Pfam	PF00808	2.7E-29	31	95	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	2.1E-21	59	77	No hit	No description
PROSITE pattern	PS00685	0	62	78	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	2.1E-21	78	96	No hit	No description
PRINTS	PR00615	2.1E-21	97	115	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 171 aa Download sequence Send to blast
MSDAPPSPTH ESGGEQSPRG SSSGAREQDR YLPIANISRI MKKALPPNGK IAKDAKDTMQ 60 ECVSEFISFI TSEASEKCQK EKRKTINGDD LLWAMATLGF EDYIEPLKVY LARYREGDTK 120 GSARSGDGSA TPDQVGLAGQ NSQLVHQGSL NYIGLQVQPQ HLVMPSMQSH E

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	4e-49	26	116	2	92	Transcription factor HapC (Eurofung)
4g92_B	4e-49	26	116	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN01010.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FJ775529	0.0	FJ775529.1 Glycine max CCAAT-binding transcription factor family protein (NF-YB1a) mRNA, complete cds.
GenBank	FJ775530	0.0	FJ775530.1 Glycine max CCAAT-binding transcription factor family protein (NF-YB1b) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003556333.1	1e-124	nuclear transcription factor Y subunit B-1 isoform X1
Refseq	XP_028222692.1	1e-124	nuclear transcription factor Y subunit B-1-like
Refseq	XP_028222693.1	1e-124	nuclear transcription factor Y subunit B-1-like
Swissprot	Q8VYK4	8e-73	NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBL	A0A0R4J671	1e-123	A0A0R4J671_SOYBN; Uncharacterized protein
TrEMBL	A0A445F7L7	1e-123	A0A445F7L7_GLYSO; Nuclear transcription factor Y subunit B-8 isoform A
STRING	GLYMA20G34050.2	1e-123	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2545	33	82

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G37060.3	3e-75	nuclear factor Y, subunit B8

Publications ? help Back to Top
Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]