![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KHN04705.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 137aa MW: 15753.8 Da PI: 6.1279 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 82.4 | 5.2e-26 | 62 | 115 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
kprl+W eLH++F+ av+ L G++kA Pk+il+lm+v+gLt+e+v+SHLQkY+l
KHN04705.1 62 KPRLVWDVELHRKFLVAVDDL-GIDKAFPKRILDLMNVEGLTRENVASHLQKYKL 115
79*******************.*******************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 10.797 | 59 | 118 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.3E-26 | 60 | 119 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 8.78E-18 | 60 | 119 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 2.6E-23 | 62 | 115 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 1.4E-5 | 65 | 114 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 137 aa Download sequence Send to blast |
MAGKFANEEK ASYMAGECSQ AMAPKNNTDQ NIKLGQKRKE QSEDEEEEEY HKENEEHLNQ 60 NKPRLVWDVE LHRKFLVAVD DLGIDKAFPK RILDLMNVEG LTRENVASHL QKYKLDLRKP 120 TRQPSMVAKL GSSDPCL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1irz_A | 1e-23 | 60 | 119 | 3 | 62 | ARR10-B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins (By similarity). Functions as a response regulator in response to cytokinins (PubMed:22383541). {ECO:0000250|UniProtKB:Q940D0, ECO:0000269|PubMed:22383541}. | |||||
| UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KHN04705.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003541468.1 | 4e-68 | two-component response regulator ARR12 | ||||
| Refseq | XP_028188502.1 | 3e-68 | two-component response regulator ARR12-like | ||||
| Swissprot | B8B3I4 | 3e-30 | ORR22_ORYSI; Two-component response regulator ORR22 | ||||
| Swissprot | Q5SML5 | 4e-30 | ORR22_ORYSJ; Two-component response regulator ORR22 | ||||
| TrEMBL | A0A0B2P605 | 2e-97 | A0A0B2P605_GLYSO; Two-component response regulator ARR1 | ||||
| STRING | GLYMA14G19985.1 | 9e-94 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF26846 | 2 | 3 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G16857.1 | 1e-24 | response regulator 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




