PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN05528.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

GRAS

Protein Properties

Length: 108aa MW: 12008.6 Da PI: 4.5068

Description

GRAS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN05528.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GRAS	67.1	3.4e-21	1	85	207	294
GRAS 207 vlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294 +lql++llde+ + + + L+l ksl+Pk+v++ e ea+ ++ F++rf a++y+sa+f+sle +l+++s er vE llgr+i KHN05528.1 1 MLQLYNLLDEPPTAVD---TALRLAKSLNPKIVTLGEYEASVTRFGFVNRFKTAFKYFSAVFESLEPNLAADSPERFQVESLLLGRRI 85 5789999998888887...*******************************************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03514	1.2E-18	1	85	IPR005202	Transcription factor GRAS
PROSITE profile	PS50985	14.462	1	108	IPR005202	Transcription factor GRAS

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated

Sequence ? help Back to Top
Protein Sequence Length: 108 aa Download sequence Send to blast
MLQLYNLLDE PPTAVDTALR LAKSLNPKIV TLGEYEASVT RFGFVNRFKT AFKYFSAVFE 60 SLEPNLAADS PERFQVESLL LGRRIPVGEE GEYGGQRAVE GSDGACWF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5hyz_A	1e-23	1	107	208	314	GRAS family transcription factor containing protein, expressed
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in plant development (By similarity). Involved in environmental abiotic stress resistance. May increase the expression of stress-responsive genes (PubMed:20616154). Binds DNA in vitro (By similarity). {ECO:0000250\|UniProtKB:Q53K16, ECO:0000250\|UniProtKB:Q9SCR0, ECO:0000269\|PubMed:20616154}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN05528.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by drought and high salt stresses, and down-regulated by gibberellic acid (GA) treatment, but not by plant hormone abscisic acid (ABA) application in leaves. Under the salt treatment, expression is induced quickly, and it peaks at 3 hours. Under the drought treatment, the expression is not induced immediately, but reaches its maximum at 3 hours. Under the GA treatment, the expression becomes weaker within 5 hours. {ECO:0000269\|PubMed:20616154}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006591548.1	2e-50	SCARECROW-LIKE protein 7
Swissprot	A0A024B7I0	8e-34	SCL7_POPEU; SCARECROW-LIKE protein 7
TrEMBL	A0A368UHK0	3e-50	A0A368UHK0_SOYBN; Uncharacterized protein
STRING	GLYMA11G09761.1	9e-51	(Glycine max)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G66770.1	2e-35	GRAS family protein

Publications ? help Back to Top
Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933]