PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN06397.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

Dof

Protein Properties

Length: 165aa MW: 19011.4 Da PI: 9.3217

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN06397.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	124	4.9e-39	44	102	2	60
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k KHN06397.1 44 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKVKP 102 68999***************************************************885 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	3.0E-30	43	101	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	6.3E-32	46	101	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	28.118	48	102	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	50	86	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010214	Biological Process	seed coat development
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 165 aa Download sequence Send to blast
MAEAQSGQAS EGIKLFGTTI TLHGRERKED RNDSEDGTEE IKRPDKIIPC PRCKSMETKF 60 CYFNNYNVNQ PRHFCKGCQR YWTAGGALRN VPVGAGRRKV KPQFGQEERL ALDEWHVAAV 120 AHGDFRQLFP SKRRRMSSAQ HESQRKFVII HEITEHPNQI ETKEA

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269\|PubMed:19619493}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00166	DAP	Transfer from AT1G29160	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN06397.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269\|PubMed:19619493}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT092679	0.0	BT092679.1 Soybean clone JCVI-FLGm-11D11 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001237635.1	1e-123	uncharacterized protein LOC100527802
Refseq	XP_028232855.1	1e-123	dof zinc finger protein DOF1.5-like isoform X1
Swissprot	P68350	1e-51	DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBL	A0A445KPG3	1e-121	A0A445KPG3_GLYSO; Dof zinc finger protein DOF1.5
TrEMBL	C6T5G7	1e-121	C6T5G7_SOYBN; Uncharacterized protein
STRING	GLYMA05G29090.1	1e-122	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF6483	32	51

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G29160.1	6e-54	Dof family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933] Bueso E, et al. Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration. Plant J., 2016. 87(6): p. 583-96 [PMID:27227784]