![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KHN08505.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 138aa MW: 15897.4 Da PI: 7.1505 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 138.9 | 1.4e-43 | 57 | 133 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
Cqv+gC+adlseak yhrrhkvCe h+kap+v++ +++qrfCqqCsrfhelsefD++krsCrrrLa+hnerrrk+++
KHN08505.1 57 CQVDGCNADLSEAKPYHRRHKVCEYHAKAPAVVIGDQHQRFCQQCSRFHELSEFDDSKRSCRRRLAGHNERRRKNAS 133
**************************************************************************875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PIRSF | PIRSF037575 | 1.1E-58 | 2 | 138 | IPR017238 | Squamosa promoter-binding protein |
| Gene3D | G3DSA:4.10.1100.10 | 7.7E-37 | 50 | 118 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 32.684 | 54 | 131 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 9.03E-40 | 55 | 135 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 1.1E-34 | 57 | 130 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 138 aa Download sequence Send to blast |
MDGSWSEGKR SMSYKEEDEY EEEEEEEVSE YGDDGKKKRV VSNKRGSKAG GSVPPSCQVD 60 GCNADLSEAK PYHRRHKVCE YHAKAPAVVI GDQHQRFCQQ CSRFHELSEF DDSKRSCRRR 120 LAGHNERRRK NASEYHGL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 2e-36 | 49 | 130 | 3 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KHN08505.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015038 | 5e-77 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003541730.1 | 1e-97 | squamosa promoter-binding protein 1 isoform X1 | ||||
| Refseq | XP_028189121.1 | 1e-97 | squamosa promoter-binding protein 1-like | ||||
| Swissprot | Q38741 | 2e-48 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
| TrEMBL | A0A445I985 | 2e-96 | A0A445I985_GLYSO; Squamosa promoter-binding-like protein | ||||
| TrEMBL | I1M219 | 2e-96 | I1M219_SOYBN; Squamosa promoter-binding-like protein | ||||
| STRING | GLYMA13G31090.1 | 4e-97 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF535 | 34 | 153 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G33810.1 | 1e-40 | squamosa promoter binding protein-like 3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




