![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KHN11197.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 103aa MW: 11564.5 Da PI: 10.4347 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 46.7 | 6.7e-15 | 6 | 63 | 18 | 75 |
NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlk 75
++++P arikki++adedv +i+ +Pvl+ska elf+ +l r++ + + +t++
KHN11197.1 6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYEITLQRGAKTMN 63
5789*****************************************9999888888876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 5.3E-25 | 3 | 68 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 5.83E-15 | 4 | 68 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.3E-18 | 8 | 67 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDRT YEITLQRGAK 60 TMNSLHLTNW EGINKQNGSN GKANSCTWCT RAGKTPAKMH MNM |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1jfi_A | 2e-22 | 2 | 67 | 5 | 70 | Transcription Regulator NC2 alpha chain |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KHN11197.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT094638 | 1e-106 | BT094638.1 Soybean clone JCVI-FLGm-18N24 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014623604.1 | 3e-42 | class 2 transcription repressor NC2 alpha 6 isoform X1 | ||||
| Refseq | XP_028204342.1 | 3e-42 | dr1-associated corepressor-like isoform X1 | ||||
| Swissprot | A0JPP1 | 7e-21 | NC2A_RAT; Dr1-associated corepressor | ||||
| Swissprot | Q14919 | 6e-21 | NC2A_HUMAN; Dr1-associated corepressor | ||||
| Swissprot | Q2YDP3 | 7e-21 | NC2A_BOVIN; Dr1-associated corepressor | ||||
| TrEMBL | A0A0B2PUJ1 | 1e-71 | A0A0B2PUJ1_GLYSO; Dr1-associated corepressor | ||||
| STRING | XP_010067677.1 | 3e-40 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1728 | 34 | 91 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G12480.1 | 1e-41 | nuclear factor Y, subunit C11 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




