PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN12754.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

MYB

Protein Properties

Length: 90aa MW: 10224.7 Da PI: 11.455

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN12754.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.3	1.6e-17	1	46	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++ Ed +l +v+ +G+++W++I+r++ gR++k+c++rw + KHN12754.1 1 KGPWSAKEDRILTGLVEAHGPRNWASISRHIK-GRSGKSCRLRWCNQ 46 79***************************9.*********985 PP
2	Myb_DNA-binding	39.9	9.6e-13	55	90	3	40
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40 +++t Ede +++a++++G++ W+tIar+++ gRt++ + KHN12754.1 55 PFSTREDEVILHAHARFGNK-WATIARMLP-GRTDNAV 90 89****************.*****.**975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	8.2E-12	1	49	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	25.893	1	51	IPR017930	Myb domain
Pfam	PF00249	1.3E-16	1	46	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.56E-27	1	90	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.1E-23	2	54	IPR009057	Homeodomain-like
CDD	cd00167	9.67E-13	3	45	No hit	No description
SMART	SM00717	0.9	52	90	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	13.038	53	90	IPR017930	Myb domain
CDD	cd00167	5.04E-7	55	90	No hit	No description
Pfam	PF00249	6.0E-10	55	90	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.9E-15	55	90	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
KGPWSAKEDR ILTGLVEAHG PRNWASISRH IKGRSGKSCR LRWCNQLSPT VEHRPFSTRE 60 DEVILHAHAR FGNKWATIAR MLPGRTDNAV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	4e-32	1	90	4	93	MYB PROTO-ONCOGENE PROTEIN
1h88_C	2e-31	1	90	58	147	MYB PROTO-ONCOGENE PROTEIN
1h89_C	2e-31	1	90	58	147	MYB PROTO-ONCOGENE PROTEIN
1mse_C	4e-32	1	90	4	93	C-Myb DNA-Binding Domain
1msf_C	4e-32	1	90	4	93	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269\|PubMed:23809151, ECO:0000269\|PubMed:24894996}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN12754.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress. {ECO:0000269\|PubMed:23809151}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003549412.2	5e-61	transcription factor MYB25
Refseq	XP_028210122.1	5e-61	transcription factor MYB25-like
Swissprot	O23160	2e-43	MYB73_ARATH; Transcription factor MYB73
TrEMBL	A0A445GBJ5	1e-59	A0A445GBJ5_GLYSO; Transcription factor MYB73
TrEMBL	K7MNR7	1e-59	K7MNR7_SOYBN; Uncharacterized protein
STRING	GLYMA17G36370.2	2e-60	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF5074	32	56

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G37260.1	6e-46	myb domain protein 73

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933]