![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KHN15471.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 99aa MW: 11465.2 Da PI: 9.0093 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 111.8 | 4e-35 | 1 | 89 | 8 | 96 |
NF-YB 8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
+Pi+nv++i ++lP+nakis da +++q+ ++++i fvt +a ++cq e rk +n++dllwa+ +lGf+dyvepl++++++yr++eg
KHN15471.1 1 MPITNVTKITGQILPNNAKISYDAMDMIQQGATKYINFVTRKAKEQCQSEYRKIMNAEDLLWAMKKLGFNDYVEPLTAFVQRYRNIEGS 89
8*************************************************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 1.3E-23 | 1 | 90 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 2.0E-31 | 1 | 89 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.3E-15 | 1 | 64 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.1E-11 | 28 | 46 | No hit | No description |
| PRINTS | PR00615 | 1.1E-11 | 47 | 65 | No hit | No description |
| PRINTS | PR00615 | 1.1E-11 | 66 | 84 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
MPITNVTKIT GQILPNNAKI SYDAMDMIQQ GATKYINFVT RKAKEQCQSE YRKIMNAEDL 60 LWAMKKLGFN DYVEPLTAFV QRYRNIEGSD LFTSHKEPI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 2e-31 | 1 | 85 | 13 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KHN15471.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014628426.1 | 5e-69 | nuclear transcription factor Y subunit beta | ||||
| Swissprot | Q84W66 | 5e-31 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | A0A0B2Q1K0 | 5e-69 | A0A0B2Q1K0_GLYSO; Nuclear transcription factor Y subunit B-6 (Fragment) | ||||
| TrEMBL | A0A0R0KTG7 | 1e-67 | A0A0R0KTG7_SOYBN; Uncharacterized protein | ||||
| TrEMBL | A0A445LL90 | 5e-67 | A0A445LL90_GLYSO; Nuclear transcription factor Y subunit B-6 | ||||
| STRING | GLYMA07G29695.1 | 2e-54 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF591 | 34 | 150 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 8e-34 | nuclear factor Y, subunit B6 | ||||




