PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN16115.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

NF-YB

Protein Properties

Length: 141aa MW: 16011.1 Da PI: 8.073

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN16115.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	160.4	2.7e-50	4	99	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 eqdr lPianvsrimk++lP akisk+ k+++qecv+efisfvt+easdkc++e+rkt+ngdd++wal++lGf++y+e++ yl+kyr++e+ek KHN16115.1 4 DEQDRALPIANVSRIMKQILPPSAKISKEGKQVMQECVTEFISFVTGEASDKCHKENRKTVNGDDICWALSSLGFDNYAEAIGRYLHKYRQAEREK 99 59*******************************************************************************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	3.7E-48	3	109	IPR009072	Histone-fold
SuperFamily	SSF47113	1.86E-37	6	112	IPR009072	Histone-fold
Pfam	PF00808	3.8E-25	9	73	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.4E-18	37	55	No hit	No description
PROSITE pattern	PS00685	0	40	56	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.4E-18	56	74	No hit	No description
PRINTS	PR00615	1.4E-18	75	93	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 141 aa Download sequence Send to blast
MDQDEQDRAL PIANVSRIMK QILPPSAKIS KEGKQVMQEC VTEFISFVTG EASDKCHKEN 60 RKTVNGDDIC WALSSLGFDN YAEAIGRYLH KYRQAEREKI NHDKKYENPH INRAPPPPLL 120 LSRVTRDKVE NPPPSPPNQS G

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-42	5	94	3	92	Transcription factor HapC (Eurofung)
4g92_B	2e-42	5	94	3	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00133	DAP	Transfer from AT1G09030	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN16115.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC235914	0.0	AC235914.2 Glycine max clone GM_WBc0225O17, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003535337.1	1e-103	nuclear transcription factor Y subunit B-4
Refseq	XP_028183985.1	1e-103	nuclear transcription factor Y subunit B-4-like
Refseq	XP_028183986.1	1e-103	nuclear transcription factor Y subunit B-4-like
Refseq	XP_028183987.1	1e-103	nuclear transcription factor Y subunit B-4-like
Swissprot	O04027	2e-54	NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBL	A0A445IMX3	1e-101	A0A445IMX3_GLYSO; Nuclear transcription factor Y subunit B-4 isoform A
TrEMBL	K7LJK2	1e-101	K7LJK2_SOYBN; Uncharacterized protein
STRING	GLYMA10G29440.2	1e-102	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF805	32	131

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09030.1	8e-57	nuclear factor Y, subunit B4

Publications ? help Back to Top
Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]