![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KHN17019.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 95aa MW: 11088.8 Da PI: 10.0756 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 51.7 | 1.9e-16 | 31 | 80 | 3 | 52 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52
+ +r+rr++kNRe+A rsR+RK+a++ eLe + +Le+eN++L ke e++
KHN17019.1 31 AQQRQRRMIKNRESAARSRERKQAYQVELESLAVKLEEENDKLLKEKETI 80
679*****************************************998876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PRINTS | PR00041 | 8.8E-5 | 28 | 44 | IPR001630 | cAMP response element binding (CREB) protein |
| SMART | SM00338 | 1.4E-10 | 29 | 95 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.576 | 31 | 81 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 1.1E-14 | 31 | 80 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14707 | 3.80E-14 | 33 | 85 | No hit | No description |
| SuperFamily | SSF57959 | 6.88E-11 | 33 | 79 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 3.6E-14 | 34 | 81 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 36 | 51 | IPR004827 | Basic-leucine zipper domain |
| PRINTS | PR00041 | 8.8E-5 | 46 | 66 | IPR001630 | cAMP response element binding (CREB) protein |
| PRINTS | PR00041 | 8.8E-5 | 66 | 83 | IPR001630 | cAMP response element binding (CREB) protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MDDTSQCLLT KRLGNGTLFS FDHLPTLDKA AQQRQRRMIK NRESAARSRE RKQAYQVELE 60 SLAVKLEEEN DKLLKEKETI SFALCRTSKL KPFRC |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KHN17019.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_028219753.1 | 3e-32 | G-box-binding factor 4-like isoform X1 | ||||
| Swissprot | P42777 | 2e-21 | GBF4_ARATH; G-box-binding factor 4 | ||||
| TrEMBL | A0A445IR92 | 4e-31 | A0A445IR92_GLYSO; G-box-binding factor 4 isoform B | ||||
| STRING | GLYMA10G36820.2 | 1e-29 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2028 | 34 | 81 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G03970.1 | 9e-17 | G-box binding factor 4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




