PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN18030.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

SBP

Protein Properties

Length: 91aa MW: 10157.4 Da PI: 8.9968

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN18030.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	60.4	4.5e-19	48	91	1	44
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-T CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCq 44 +Cq+egC+adls+ak+yh+rhkvCe+hska++++++gl+qr Cq KHN18030.1 48 RCQAEGCNADLSQAKHYHHRHKVCEFHSKAATIIAAGLTQRLCQ 91 6******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	3.0E-20	44	91	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	17.136	46	91	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	5.23E-18	47	91	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	1.2E-13	49	91	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MDFVGSRIGL NMGGRTYFSS SEDDFVSRLY RRSRPVEPGS TILSNSPRCQ AEGCNADLSQ 60 AKHYHHRHKV CEFHSKAATI IAAGLTQRLC Q

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj0_A	3e-13	49	91	6	48	squamosa promoter-binding protein-like 12
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269\|PubMed:12671094, ECO:0000269\|PubMed:16095614, ECO:0000269\|PubMed:17093870}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN18030.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003530168.1	3e-57	squamosa promoter-binding-like protein 8
Refseq	XP_028240023.1	3e-57	squamosa promoter-binding-like protein 8
Swissprot	Q8GXL3	1e-44	SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBL	A0A0B2Q9S8	4e-62	A0A0B2Q9S8_GLYSO; Squamosa promoter-binding-like protein 8
TrEMBL	A0A445GGQ0	4e-61	A0A445GGQ0_GLYSO; Squamosa promoter-binding-like protein 8
STRING	GLYMA16G19464.1	2e-62	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF6801	33	48

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G02065.2	4e-48	squamosa promoter binding protein-like 8

Publications ? help Back to Top
Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933] Xing S, et al. SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility. Plants (Basel), 2013. 2(3): p. 416-28 [PMID:27137384]