![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KHN18381.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 239aa MW: 27463.3 Da PI: 9.6042 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 91.2 | 5e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtfskRr g+lKKA E+SvLCda+va+i+fs++gkl++ys+
KHN18381.1 9 KRIENKINRQVTFSKRRSGLLKKAREISVLCDADVALIVFSTKGKLFDYSN 59
79***********************************************95 PP
| |||||||
| 2 | K-box | 96.5 | 4.3e-32 | 77 | 173 | 3 | 99 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99
+++ ++a +e++ e++kLk+++e Lqr+qR+++GedL+sL+l+ Lq+LeqqL+++lk iRs+Kn+ + e+i+ lqkk k+l+e+n+ L+kk++
KHN18381.1 77 ERQLAGDDQAPNENWVIEHEKLKARVEVLQRNQRNFMGEDLDSLNLRGLQSLEQQLDSALKLIRSRKNQAMNESISALQKKDKSLREHNNLLSKKIK 173
5566666778899**********************************************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 3.1E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 30.992 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.75E-32 | 2 | 92 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.28E-40 | 2 | 79 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.3E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.5E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.3E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.3E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 2.4E-26 | 85 | 172 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 15.631 | 88 | 178 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0055114 | Biological Process | oxidation-reduction process | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0032440 | Molecular Function | 2-alkenal reductase [NAD(P)] activity | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 239 aa Download sequence Send to blast |
MGRGRVDLKR IENKINRQVT FSKRRSGLLK KAREISVLCD ADVALIVFST KGKLFDYSNE 60 PCMKRILERY ERYSYAERQL AGDDQAPNEN WVIEHEKLKA RVEVLQRNQR NFMGEDLDSL 120 NLRGLQSLEQ QLDSALKLIR SRKNQAMNES ISALQKKDKS LREHNNLLSK KIKDKEKELA 180 PQEQDGLQNN MDVTSVLVTQ PPESLTIGGF PEAKCNEETP TSSRPKTILP PWMPLPTNE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 5e-19 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 5e-19 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 5e-19 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 5e-19 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6byy_A | 5e-19 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_B | 5e-19 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_C | 5e-19 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_D | 5e-19 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_A | 5e-19 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_B | 5e-19 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_C | 5e-19 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_D | 5e-19 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6c9l_A | 5e-19 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 5e-19 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 5e-19 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 5e-19 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 5e-19 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 5e-19 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1 and CAULIFLOWER. Is required subsequently for the transition of an inflorescence meristem into a floral meristem (PubMed:28586421). Seems to be partially redundant to the function of APETALA1 and CAULIFLOWER in the up-regulation of LEAFY. Is also required for normal pattern of cell division, expansion and differentiation during morphogenesis of the silique (PubMed:28586421). Probably not required for fruit elongation but instead is required to prevent ectopic activity of IND. Represses SAUR10 expression in stems and inflorescence branches (PubMed:28586421). {ECO:0000269|PubMed:10648231, ECO:0000269|PubMed:15035986, ECO:0000269|PubMed:28586421, ECO:0000269|PubMed:9502732}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KHN18381.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Dramatically up-regulated upon the transition from vegetative to reproductive development. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KT031177 | 0.0 | KT031177.1 Glycine max clone HN_CCL_28 MADS transcription factor (Glyma05g07380.1) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003549579.1 | 1e-176 | truncated transcription factor CAULIFLOWER A isoform X2 | ||||
| Refseq | XP_028209377.1 | 1e-176 | truncated transcription factor CAULIFLOWER A-like isoform X2 | ||||
| Swissprot | Q38876 | 1e-104 | AGL8_ARATH; Agamous-like MADS-box protein AGL8 | ||||
| TrEMBL | I1MT91 | 1e-175 | I1MT91_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA17G08890.1 | 1e-176 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF588 | 32 | 119 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G60910.1 | 1e-107 | AGAMOUS-like 8 | ||||




