![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KHN18821.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 125aa MW: 14556.6 Da PI: 10.4608 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 103.6 | 1.1e-32 | 34 | 92 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk++ +prsYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+
KHN18821.1 34 LDDGYRWRKYGQKAVKNNIHPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 92
59********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 5.7E-34 | 20 | 92 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 3.53E-29 | 26 | 93 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 29.172 | 29 | 94 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.5E-37 | 34 | 93 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 4.1E-26 | 35 | 92 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 125 aa Download sequence Send to blast |
MAEKSDKETM KGGRLRKTTR PRFAFQTRSE DDILDDGYRW RKYGQKAVKN NIHPRSYYRC 60 THHTCNVKKQ VQRLSKDTSI VVTTYEGIHN HPCEKLMETL TPLLRQMQFL SRLASNNNGG 120 PSSLL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 5e-27 | 24 | 91 | 7 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 5e-27 | 24 | 91 | 7 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KHN18821.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_028206835.1 | 2e-91 | probable WRKY transcription factor 43 | ||||
| Swissprot | Q8VWQ4 | 4e-58 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
| TrEMBL | A0A0B2QB56 | 4e-90 | A0A0B2QB56_GLYSO; Putative WRKY transcription factor 56 | ||||
| TrEMBL | A0A445GDL7 | 6e-90 | A0A445GDL7_GLYSO; Putative WRKY transcription factor 56 | ||||
| STRING | GLYMA16G03480.2 | 3e-90 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF3227 | 34 | 71 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G64000.1 | 2e-60 | WRKY DNA-binding protein 56 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




