PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN20547.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

MIKC_MADS

Protein Properties

Length: 174aa MW: 20121.3 Da PI: 9.8396

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN20547.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	100.7	5.5e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+ KHN20547.1 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59 79***********************************************95 PP
2	K-box	76.8	5.6e-26	58	124	33	99
K-box 33 reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 ++++hl+G+ L++L++keL+qLe++Le+++++iRskK+e+ll++ie+ qk+e el++en +Lr+k+ KHN20547.1 58 SNNKHLMGDALSTLTVKELKQLENRLERGITRIRSKKHEMLLAEIEYFQKREIELENENLCLRTKIT 124 5789************************************************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-42	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	34.048	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.88E-30	2	67	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.17E-39	2	60	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.9E-33	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.0E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.9E-33	23	38	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	10.186	33	129	IPR002487	Transcription factor, K-box
PRINTS	PR00404	2.9E-33	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	1.3E-18	59	123	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 174 aa Download sequence Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN 60 KHLMGDALST LTVKELKQLE NRLERGITRI RSKKHEMLLA EIEYFQKREI ELENENLCLR 120 TKITDVERIQ QVNMVSGPEL NAIQALASRN FFNPNMLEGG TVYPHSDKKI LHLG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_R	2e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_S	2e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_A	2e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_B	2e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_C	2e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_D	2e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_E	2e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_F	2e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269\|PubMed:21447172, ECO:0000269\|PubMed:29853599, ECO:0000269\|Ref.1}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN20547.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ371899	0.0	DQ371899.1 Glycine max MADS domain transporter AGL11 (AGL11) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001236130.1	1e-116	MADS domain transporter AGL11
Refseq	XP_006580912.1	1e-116	MADS domain transporter AGL11 isoform X1
Refseq	XP_006580913.1	1e-116	MADS domain transporter AGL11 isoform X2
Refseq	XP_014631604.1	1e-116	MADS domain transporter AGL11 isoform X1
Refseq	XP_028238522.1	1e-116	agamous-like MADS-box protein AGL11
Refseq	XP_028238523.1	1e-116	agamous-like MADS-box protein AGL11
Refseq	XP_028238524.1	1e-116	agamous-like MADS-box protein AGL11
Swissprot	F6I457	7e-98	AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBL	A0A0B2QLC4	1e-124	A0A0B2QLC4_GLYSO; Agamous-like MADS-box protein AGL11
STRING	GLYMA06G48270.2	1e-116	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF684	29	102

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09960.1	2e-81	MIKC_MADS family protein

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Mejía N, et al. Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine. BMC Plant Biol., 2011. 11: p. 57 [PMID:21447172] Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Malabarba J, et al. The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine. J. Exp. Bot., 2017. 68(7): p. 1493-1506 [PMID:28369525] Royo C, et al. The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11. Plant Physiol., 2018. 177(3): p. 1234-1253 [PMID:29853599]