![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KHN22167.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 108aa MW: 12037.8 Da PI: 5.9122 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 148 | 1.9e-46 | 23 | 108 | 2 | 87 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87
re drflPianvsrimkk+l anaki k aketvqecvsefisf+ +easdkcqrekrk ingddllwa++tlGfedyveplk yl
KHN22167.1 23 RELDRFLPIANVSRIMKKALLANAKILKYAKETVQECVSEFISFIIDEASDKCQREKRKVINGDDLLWAMTTLGFEDYVEPLKGYL 108
789********************************************************************************997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.7E-42 | 21 | 108 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 7.3E-31 | 26 | 108 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 7.4E-23 | 28 | 92 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 8.0E-17 | 56 | 74 | No hit | No description |
| PRINTS | PR00615 | 8.0E-17 | 75 | 93 | No hit | No description |
| PRINTS | PR00615 | 8.0E-17 | 94 | 108 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 108 aa Download sequence Send to blast |
MADSDNDSGG AHNSGKGGKV LPRELDRFLP IANVSRIMKK ALLANAKILK YAKETVQECV 60 SEFISFIIDE ASDKCQREKR KVINGDDLLW AMTTLGFEDY VEPLKGYL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 9e-39 | 23 | 108 | 2 | 87 | Transcription factor HapC (Eurofung) |
| 4g92_B | 9e-39 | 23 | 108 | 2 | 87 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KHN22167.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT017830 | 3e-74 | BT017830.1 Zea mays clone EL01N0508H10.c mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006602134.1 | 2e-65 | nuclear transcription factor Y subunit B-3 | ||||
| Refseq | XP_028214205.1 | 2e-65 | nuclear transcription factor Y subunit B-3-like | ||||
| Swissprot | Q75IZ7 | 3e-58 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A0B2QR59 | 4e-74 | A0A0B2QR59_GLYSO; Nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | K7KDZ5 | 4e-74 | K7KDZ5_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA03G22721.1 | 7e-75 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF591 | 34 | 150 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 3e-50 | nuclear factor Y, subunit B3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




