![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KHN27634.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 129aa MW: 14082.6 Da PI: 7.3365 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 101.9 | 5.8e-32 | 10 | 77 | 1 | 68 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAear 68
+CaaCk+lrrkC +dC+++pyfp e+p+kfanvhk+FGasnv+kll+++++++reda++sl+yeAea+
KHN27634.1 10 PCAACKFLRRKCMPDCIFSPYFPPEEPQKFANVHKIFGASNVSKLLNEVQPHQREDAVNSLAYEAEAQ 77
7****************************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 18.315 | 9 | 109 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 4.3E-31 | 10 | 77 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0004088 | Molecular Function | carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 129 aa Download sequence Send to blast |
MASSSYSNSP CAACKFLRRK CMPDCIFSPY FPPEEPQKFA NVHKIFGASN VSKLLNEVQP 60 HQREDAVNSL AYEAEAQGSS LWLCWGNFSA PKARGGGGGS SLGQSPGYYY PSPWNNDPLG 120 DGYHRGDNI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 1e-40 | 7 | 90 | 8 | 92 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 1e-40 | 7 | 90 | 8 | 92 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KHN27634.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT090839 | 1e-140 | BT090839.1 Soybean clone JCVI-FLGm-5B3 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007140816.1 | 4e-70 | hypothetical protein PHAVU_008G144700g | ||||
| Refseq | XP_007140817.1 | 4e-70 | hypothetical protein PHAVU_008G144700g | ||||
| Refseq | XP_007140818.1 | 5e-70 | hypothetical protein PHAVU_008G144700g | ||||
| Refseq | XP_027338031.1 | 4e-70 | LOB domain-containing protein 25-like | ||||
| Swissprot | Q9FML4 | 8e-43 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A0B2R616 | 7e-91 | A0A0B2R616_GLYSO; Protein LATERAL ORGAN BOUNDARIES | ||||
| STRING | XP_007140818.1 | 2e-69 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1091 | 34 | 112 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 3e-45 | LBD family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




