![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KHN28509.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 88aa MW: 10265.9 Da PI: 10.4579 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 28.4 | 3.7e-09 | 2 | 38 | 10 | 47 |
HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
el+ + +++G+g+Wk I+r + +R + q+ s+ qky
KHN28509.1 2 ELFMLGLQKYGKGDWKNISRIIK-TRNPTQVASHVQKY 38
789999****************9.*************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 12.872 | 1 | 43 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 3.59E-10 | 2 | 43 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.3E-6 | 2 | 38 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.4E-5 | 2 | 37 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.50E-6 | 2 | 39 | No hit | No description |
| TIGRFAMs | TIGR01557 | 6.4E-10 | 3 | 40 | IPR006447 | Myb domain, plants |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MELFMLGLQK YGKGDWKNIS RIIKTRNPTQ VASHVQKYFL LQASSNKGKR RSIHDMVLPD 60 GPVPHRIYQQ NEVSFPNLYV PITHHIDH |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KHN28509.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010418602.1 | 2e-20 | PREDICTED: transcription factor DIVARICATA-like | ||||
| Refseq | XP_027908514.1 | 1e-20 | transcription factor DIVARICATA-like | ||||
| Swissprot | Q8S9H7 | 1e-17 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
| TrEMBL | A0A0B2R8L5 | 2e-59 | A0A0B2R8L5_GLYSO; Transcription factor MYB1R1 | ||||
| STRING | XP_010418602.1 | 8e-20 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF13860 | 4 | 14 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G58900.1 | 8e-21 | Homeodomain-like transcriptional regulator | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




