PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30251.1
Organism
Glycine soja
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 137aa    MW: 15504 Da    PI: 10.3802
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30251.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.36.1e-212673249
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                +  n+sn  vtfskRr+g++KKA+EL +LC+++vavi+fs+ ++++ +
  KHN30251.1 26 KMRNESNLWVTFSKRRTGVFKKASELATLCGMDVAVIMFSPGNRVFSF 73
                56799***************************************9988 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.0861777IPR002100Transcription factor, MADS-box
SMARTSM004324.4E-281776IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.54E-261895IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-171939IPR002100Transcription factor, MADS-box
PfamPF003193.8E-222773IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-173954IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-175475IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MESNNMPDLN GVAKKTKGQQ KIEMKKMRNE SNLWVTFSKR RTGVFKKASE LATLCGMDVA  60
VIMFSPGNRV FSFGSPSVDS VVQRYKTQGP PPLLTLDLNK VHSTVPIESM TDSQLDKYKK  120
MLEEFKRQLK EKCGNLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-151891275Myocyte-specific enhancer factor 2B
1tqe_Q2e-151891275Myocyte-specific enhancer factor 2B
1tqe_R2e-151891275Myocyte-specific enhancer factor 2B
1tqe_S2e-151891275Myocyte-specific enhancer factor 2B
6c9l_A2e-151891275Myocyte-specific enhancer factor 2B
6c9l_B2e-151891275Myocyte-specific enhancer factor 2B
6c9l_C2e-151891275Myocyte-specific enhancer factor 2B
6c9l_D2e-151891275Myocyte-specific enhancer factor 2B
6c9l_E2e-151891275Myocyte-specific enhancer factor 2B
6c9l_F2e-151891275Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN30251.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2358431e-162AC235843.2 Glycine max clone GM_WBb0059O09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006589898.13e-89agamous-like MADS-box protein AGL62
RefseqXP_028184651.13e-89agamous-like MADS-box protein AGL62
SwissprotQ9FKK25e-33AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA0A0B2R7774e-97A0A0B2R777_GLYSO; Agamous-like MADS-box protein AGL62
STRINGGLYMA10G10900.11e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13864521
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-35AGAMOUS-like 62
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Xu W, et al.
    Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds.
    Plant Cell, 2016. 28(6): p. 1343-60
    [PMID:27233529]
  3. Figueiredo DD,Batista RA,Roszak PJ,Köhler C
    Auxin production couples endosperm development to fertilization.
    Nat Plants, 2015. 1: p. 15184
    [PMID:27251719]
  4. Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C
    Auxin production in the endosperm drives seed coat development in Arabidopsis.
    Elife, 2017.
    [PMID:27848912]
  5. Fiume E,Coen O,Xu W,Lepiniec L,Magnani E
    Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal.
    Plant Signal Behav, 2017. 12(8): p. e1339000
    [PMID:28613109]
  6. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]