PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN31648.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

NF-YB

Protein Properties

Length: 78aa MW: 8727 Da PI: 7.8514

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN31648.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	75.7	6.8e-24	28	75	2	49
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtse 49 reqd flPian+s imkk+lP+n ki+kdaket+qecvs+fisfvt+e KHN31648.1 28 REQDCFLPIANISCIMKKMLPSNMKIAKDAKETLQECVSKFISFVTCE 75 89*********************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.7E-21	24	75	IPR009072	Histone-fold
SuperFamily	SSF47113	4.41E-14	26	74	IPR009072	Histone-fold
Pfam	PF00808	1.8E-13	33	75	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
MFNAPASPCG SGRGNHESSE HSPRSYFREQ DCFLPIANIS CIMKKMLPSN MKIAKDAKET 60 LQECVSKFIS FVTCEYTS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1n1j_A	3e-17	27	75	2	50	NF-YB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN31648.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006595292.1	1e-48	nuclear transcription factor Y subunit B
Swissprot	Q8VYK4	4e-23	NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBL	A0A0B2RI57	2e-51	A0A0B2RI57_GLYSO; Nuclear transcription factor Y subunit B-8
STRING	GLYMA13G10690.2	5e-48	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF21273	4	4

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G37060.3	2e-25	nuclear factor Y, subunit B8

Publications ? help Back to Top
Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]