PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN33184.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

LBD

Protein Properties

Length: 55aa MW: 6410.56 Da PI: 9.9923

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN33184.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	49.2	1.6e-15	18	54	4	40
DUF260 4 aCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGas 40 aCk+lrrkC dC+++pyfp ++p+kf nvhk+F+as KHN33184.1 18 ACKFLRRKCMLDCIFSPYFPPKEPQKFTNVHKIFRAS 54 9*********************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	13.546	14	55	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	1.7E-13	17	54	IPR004883	Lateral organ boundaries, LOB

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0004088	Molecular Function	carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity

Sequence ? help Back to Top
Protein Sequence Length: 55 aa Download sequence Send to blast
IAVKIMASSS YSNSPYDACK FLRRKCMLDC IFSPYFPPKE PQKFTNVHKI FRASF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	2e-17	8	54	4	50	LOB family transfactor Ramosa2.1
5ly0_B	2e-17	8	54	4	50	LOB family transfactor Ramosa2.1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN33184.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269\|PubMed:11934861}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT090839	9e-64	BT090839.1 Soybean clone JCVI-FLGm-5B3 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007140818.1	1e-24	hypothetical protein PHAVU_008G144700g
Refseq	XP_017417992.1	1e-24	PREDICTED: LOB domain-containing protein 25-like isoform X1
Refseq	XP_027929654.1	1e-24	LOB domain-containing protein 25-like isoform X2
Swissprot	Q8L8Q3	2e-19	LBD25_ARATH; LOB domain-containing protein 25
Swissprot	Q9FML4	4e-19	LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBL	A0A0B2RLJ2	3e-32	A0A0B2RLJ2_GLYSO; LOB domain-containing protein 25 (Fragment)
STRING	GLYMA16G09720.1	5e-27	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF36399	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G27650.1	7e-22	LOB domain-containing protein 25

Publications ? help Back to Top
Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933] Kim M,Kim MJ,Pandey S,Kim J Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development. Plant Cell Physiol., 2016. 57(11): p. 2291-2299 [PMID:27519310] Xu C, et al. Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration. Nat Plants, 2018. 4(2): p. 108-115 [PMID:29358751] Liu J, et al. The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture. Plant Cell Physiol., 2018. 59(4): p. 734-743 [PMID:29361138]