PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN33732.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

bZIP

Protein Properties

Length: 155aa MW: 17431.5 Da PI: 6.9588

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN33732.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	43	9.6e-14	33	91	5	63
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+++NRe+ArrsR RK++ ++ L+ v +L +eN++ ++ ++++ ++++e+ KHN33732.1 33 RKRKRMISNRESARRSRMRKQKHLDDLASQVTQLRNENHQILTSVNLTTQKYLAVEAEN 91 7889*************************************999999999998887776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	4.9E-11	23	80	No hit	No description
SMART	SM00338	1.3E-17	29	93	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.553	31	94	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	3.7E-11	32	78	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	5.13E-13	33	84	No hit	No description
CDD	cd14702	1.30E-18	34	84	No hit	No description
PROSITE pattern	PS00036	0	36	51	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000165	Biological Process	MAPK cascade
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005622	Cellular Component	intracellular
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0004707	Molecular Function	MAP kinase activity
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 155 aa Download sequence Send to blast
MACSSGTSSG ATSSMLQNNS GSEEELQALM EQRKRKRMIS NRESARRSRM RKQKHLDDLA 60 SQVTQLRNEN HQILTSVNLT TQKYLAVEAE NSVLRAQVNE LSHWLESLNE IIHFLNATDG 120 GPPPPPSSFF EPDATFFNKA YLSQPIMASA DMLQY

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	32	53	RKRKRMISNRESARRSRMRKQK
2	45	52	RRSRMRKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269\|PubMed:15047879, ECO:0000269\|PubMed:18088315, ECO:0000269\|PubMed:21534971, ECO:0000269\|PubMed:24861440}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN33732.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269\|PubMed:15047879, ECO:0000269\|PubMed:15208401, ECO:0000269\|PubMed:9620274, ECO:0000269\|PubMed:9721683}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT089153	0.0	BT089153.1 Soybean clone JCVI-FLGm-1A14 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001237649.1	1e-113	bZIP transcription factor bZIP125
Refseq	XP_028227295.1	1e-113	bZIP transcription factor 11-like
Swissprot	O65683	2e-45	BZP11_ARATH; bZIP transcription factor 11
TrEMBL	A0A445KUH8	1e-111	A0A445KUH8_GLYSO; BZIP transcription factor 11
TrEMBL	Q0GPF7	1e-111	Q0GPF7_SOYBN; BZIP transcription factor bZIP125
STRING	GLYMA04G01210.1	1e-112	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF613	34	147

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G34590.1	2e-45	G-box binding factor 6

Publications ? help Back to Top
Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933] Mair A, et al. SnRK1-triggered switch of bZIP63 dimerization mediates the low-energy response in plants. Elife, 2016. [PMID:26263501] Sagor GH, et al. A novel strategy to produce sweeter tomato fruits with high sugar contents by fruit-specific expression of a single bZIP transcription factor gene. Plant Biotechnol. J., 2016. 14(4): p. 1116-26 [PMID:26402509] Walper E,Weiste C,Mueller MJ,Hamberg M,Dröge-Laser W Screen Identifying Arabidopsis Transcription Factors Involved in the Response to 9-Lipoxygenase-Derived Oxylipins. PLoS ONE, 2016. 11(4): p. e0153216 [PMID:27073862] Wang XY, et al. Metabolomic analysis reveals the relationship between AZI1 and sugar signaling in systemic acquired resistance of Arabidopsis. Plant Physiol. Biochem., 2016. 107: p. 273-287 [PMID:27337039] Weiste C, et al. The Arabidopsis bZIP11 transcription factor links low-energy signalling to auxin-mediated control of primary root growth. PLoS Genet., 2017. 13(2): p. e1006607 [PMID:28158182] Yamashita Y, et al. Sucrose sensing through nascent peptide-meditated ribosome stalling at the stop codon of Arabidopsis bZIP11 uORF2. FEBS Lett., 2017. 591(9): p. 1266-1277 [PMID:28369795] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Lee DH,Park SJ,Ahn CS,Pai HS MRF Family Genes Are Involved in Translation Control, Especially under Energy-Deficient Conditions, and Their Expression and Functions Are Modulated by the TOR Signaling Pathway. Plant Cell, 2017. 29(11): p. 2895-2920 [PMID:29084871] Pedrotti L, et al. Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness. Plant Cell, 2018. 30(2): p. 495-509 [PMID:29348240]