![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KHN35329.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 141aa MW: 15832.9 Da PI: 6.5085 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 142.8 | 1.4e-44 | 1 | 101 | 35 | 137 |
Whirly 35 llelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefav 133
++ ++ +++erkydW+k+q+falsatev++l+ + +++sc+ffhdp++ +sn+G+vrk+l+++P+++ G+fv+l+v n+l++++++fsvPv+ aefav
KHN35329.1 1 MMSFMHSIGERKYDWDKRQKFALSATEVGSLITMDAQDSCDFFHDPSMLSSNAGQVRKSLSIKPHAN--GYFVSLTVVNNLLNTKDYFSVPVTTAEFAV 97
899**************************************************************97..69**************************** PP
Whirly 134 lrsl 137
++++
KHN35329.1 98 MKTA 101
**97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF08536 | 1.2E-41 | 1 | 100 | IPR013742 | Plant transcription factor |
| SuperFamily | SSF54447 | 1.8E-43 | 1 | 120 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene3D | G3DSA:2.30.31.10 | 1.7E-50 | 1 | 120 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006281 | Biological Process | DNA repair | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005739 | Cellular Component | mitochondrion | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 141 aa Download sequence Send to blast |
MMSFMHSIGE RKYDWDKRQK FALSATEVGS LITMDAQDSC DFFHDPSMLS SNAGQVRKSL 60 SIKPHANGYF VSLTVVNNLL NTKDYFSVPV TTAEFAVMKT ACTFALPHIM GWDQITNQQS 120 RGIDGLQAKG DSKVSELEWE R |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3n1h_A | 2e-62 | 1 | 118 | 50 | 169 | StWhy2 |
| 3n1i_A | 2e-62 | 1 | 118 | 50 | 169 | protein StWhy2 |
| 3n1j_A | 2e-62 | 1 | 118 | 50 | 169 | Protein StWhy2 |
| 3n1k_A | 2e-62 | 1 | 118 | 50 | 169 | protein StWhy2 |
| 3n1l_A | 2e-62 | 1 | 118 | 50 | 169 | protein StWhy2 |
| 3r9y_A | 2e-62 | 1 | 118 | 50 | 169 | Why2 protein |
| 3r9z_A | 2e-62 | 1 | 118 | 50 | 169 | Why2 protein |
| 3ra0_A | 2e-62 | 1 | 118 | 50 | 169 | Why2 protein |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KHN35329.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT092146 | 0.0 | BT092146.1 Soybean clone JCVI-FLGm-10O7 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001341889.1 | 1e-103 | single-stranded DNA-bindig protein WHY2-like protein | ||||
| Refseq | XP_028226778.1 | 1e-103 | single-stranded DNA-binding protein WHY2, mitochondrial-like | ||||
| Swissprot | D9J034 | 4e-65 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
| TrEMBL | A0A0B2RSX1 | 1e-103 | A0A0B2RSX1_GLYSO; Uncharacterized protein | ||||
| TrEMBL | I1JRU0 | 1e-102 | I1JRU0_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA03G41270.1 | 1e-103 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF11383 | 33 | 38 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71260.1 | 3e-64 | WHIRLY 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




