PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN39561.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

HSF

Protein Properties

Length: 88aa MW: 9872.23 Da PI: 8.5531

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN39561.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	57.7	3.3e-18	34	88	1	55
HHHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHH CS HSF_DNA-bind 1 aFlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvR 55 aFl+k++++++d++l+ ++sw ++ sfvv++++ fa++vLpk Fkh+nf+SFvR KHN39561.1 34 AFLSKTFDLVNDPSLDLIMSWGSSTVSFVVWNPTLFARHVLPKNFKHNNFSSFVR 88 69****************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	2.7E-19	29	88	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	3.5E-6	31	88	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	8.84E-16	33	88	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	5.2E-10	35	58	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	1.5E-14	35	88	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	5.2E-10	73	85	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	5.2E-10	86	88	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MNLSSSSSQL TANFDKLNSF PHPLECLQGN PVPAFLSKTF DLVNDPSLDL IMSWGSSTVS 60 FVVWNPTLFA RHVLPKNFKH NNFSSFVR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress response. Activated by DREB2A under heat stress. {ECO:0000269\|PubMed:17999647, ECO:0000269\|PubMed:18261981}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN39561.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress. {ECO:0000269\|PubMed:17999647, ECO:0000269\|PubMed:18261981}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT096133	2e-78	BT096133.1 Soybean clone JCVI-FLGm-15K24 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014633065.1	3e-57	heat stress transcription factor A-3-like
Refseq	XP_028242049.1	3e-57	heat stress transcription factor A-3-like
Swissprot	Q8GYY1	1e-28	HSFA3_ARATH; Heat stress transcription factor A-3
TrEMBL	A0A0B2RYK8	6e-56	A0A0B2RYK8_GLYSO; Heat stress transcription factor A-3
STRING	GLYMA03G34900.1	3e-38	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1592	33	95

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G03720.1	5e-31	heat shock transcription factor A3

Publications ? help Back to Top
Jung HS, et al. Subset of heat-shock transcription factors required for the early response of Arabidopsis to excess light. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(35): p. 14474-9 [PMID:23918368] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933] Nie S,Yue H,Xing D A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance. Plant Physiol., 2016. [PMID:26099269] Hu Z, et al. Histone acetyltransferase GCN5 is essential for heat stress-responsive gene activation and thermotolerance in Arabidopsis. Plant J., 2015. 84(6): p. 1178-91 [PMID:26576681] Song C,Chung WS,Lim CO Overexpression of Heat Shock Factor Gene HsfA3 Increases Galactinol Levels and Oxidative Stress Tolerance in Arabidopsis. Mol. Cells, 2016. 39(6): p. 477-83 [PMID:27109422] Kim GD,Cho YH,Lee BH,Yoo SD STABILIZED1 Modulates Pre-mRNA Splicing for Thermotolerance. Plant Physiol., 2017. 173(4): p. 2370-2382 [PMID:28223317] Song C,Lee J,Kim T,Hong JC,Lim CO VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis. Planta, 2018. 247(6): p. 1439-1448 [PMID:29536220]