PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN40791.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

NF-YB

Protein Properties

Length: 177aa MW: 19732 Da PI: 6.9612

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN40791.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	188.2	6e-59	25	120	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 reqdrflPianvsrimkk+lPanakisk+aketvqecvsefisf+t+easdkcq+ekrktingddllwa++tlGfedyv+plk+yl+kyre+egek KHN40791.1 25 REQDRFLPIANVSRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVDPLKIYLHKYREMEGEK 120 89********************************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.0E-55	21	137	IPR009072	Histone-fold
SuperFamily	SSF47113	2.48E-42	27	133	IPR009072	Histone-fold
Pfam	PF00808	3.6E-28	30	94	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.6E-20	58	76	No hit	No description
PROSITE pattern	PS00685	0	61	77	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.6E-20	77	95	No hit	No description
PRINTS	PR00615	1.6E-20	96	114	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 177 aa Download sequence Send to blast
MAESDNESGG HTGNASGSNE LSGCREQDRF LPIANVSRIM KKALPANAKI SKEAKETVQE 60 CVSEFISFIT GEASDKCQKE KRKTINGDDL LWAMTTLGFE DYVDPLKIYL HKYREMEGEK 120 TAMMGRPHER DEGYGHGHGH ATPMMTMMMG HQPQHQHQHQ HQGHVYGSGS ASSARTR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	4e-49	25	115	2	92	Transcription factor HapC (Eurofung)
4g92_B	4e-49	25	115	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN40791.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT089346	0.0	BT089346.1 Soybean clone JCVI-FLGm-1B8 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001238398.2	1e-132	H4 superfamily
Refseq	XP_028248247.1	1e-132	nuclear transcription factor Y subunit B-3-like
Swissprot	O23310	3e-72	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	A0A445IVC8	1e-131	A0A445IVC8_GLYSO; Nuclear transcription factor Y subunit B-3
TrEMBL	I1L037	1e-131	I1L037_SOYBN; Uncharacterized protein
STRING	GLYMA09G01650.1	1e-132	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF591	34	150

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	2e-73	nuclear factor Y, subunit B3

Publications ? help Back to Top
Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]