![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KHN42077.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 101aa MW: 11936 Da PI: 7.505 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 85.1 | 9.8e-27 | 11 | 69 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+y+++ed+ ++e+isw e+gn+fvv+++ +fak++LpkyFkh+nf+SFvRQLn+Y
KHN42077.1 11 FLTKTYQLVEDPGTDEVISWGESGNTFVVWKHADFAKDLLPKYFKHNNFSSFVRQLNTY 69
9*********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.6E-28 | 3 | 69 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 8.9E-27 | 7 | 94 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 9.11E-24 | 8 | 78 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 1.0E-16 | 11 | 34 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 2.8E-22 | 11 | 69 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.0E-16 | 49 | 61 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.0E-16 | 62 | 74 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MLQQRSVPAP FLTKTYQLVE DPGTDEVISW GESGNTFVVW KHADFAKDLL PKYFKHNNFS 60 SFVRQLNTYV CFICCPFLIL LLSYLHDLVD FHRFMLFILL R |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ldu_A | 1e-20 | 1 | 69 | 11 | 78 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KHN42077.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JN896304 | 4e-95 | JN896304.1 Glycine max heat shock transcription factor HSFB1 mRNA, complete cds. | |||
| GenBank | Z46953 | 4e-95 | Z46953.1 G.max mRNA for heat shock transcription factor 34. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001340381.1 | 2e-44 | heat stress transcription factor 25 | ||||
| Refseq | XP_028186257.1 | 2e-44 | heat shock factor protein HSF24-like | ||||
| Swissprot | Q652B0 | 2e-35 | HFB2C_ORYSJ; Heat stress transcription factor B-2c | ||||
| Swissprot | Q6Z9C8 | 1e-35 | HFB2B_ORYSJ; Heat stress transcription factor B-2b | ||||
| TrEMBL | A0A445HXF7 | 4e-43 | A0A445HXF7_GLYSO; Heat shock factor protein HSF24 | ||||
| TrEMBL | A0A445M509 | 5e-43 | A0A445M509_GLYSO; Heat shock factor protein HSF24 isoform B | ||||
| TrEMBL | I1LHE9 | 4e-43 | I1LHE9_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA11G06010.1 | 6e-44 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G11660.1 | 4e-37 | HSF family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




