PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43150.1
Organism
Glycine soja
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Whirly
Protein Properties Length: 73aa    MW: 7887.2 Da    PI: 9.8551
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43150.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly60.92.7e-19136583137
      Whirly  83 kgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsl 137
                  +sn+G+vrk+l+++P+++  G+fv+l+v n+l+++n++fsvPv+ aefav++++
  KHN43150.1  13 TSSNAGQVRKSLSIKPHAN--GYFVSLTVVNNLLNTNDYFSVPVTTAEFAVMKTA 65 
                 689**************97..69******************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF544473.45E-16770IPR009044ssDNA-binding transcriptional regulator
Gene3DG3DSA:2.30.31.101.6E-161269IPR009044ssDNA-binding transcriptional regulator
PfamPF085366.1E-161365IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
MFKLSRMLPL TSTSSNAGQV RKSLSIKPHA NGYFVSLTVV NNLLNTNDYF SVPVTTAEFA  60
VMKTACSVCL LSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_A1e-23147099157Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_B1e-23147099157Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_C1e-23147099157Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_D1e-23147099157Single-stranded DNA-binding protein WHY2, mitochondrial
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that associates with mitochondrial DNA and may play a role in the regulation of the gene expression machinery. Seems also to be required to prevent break-induced DNA rearrangements in the mitochondrial genome. Can bind to melt double-stranded DNA in vivo. {ECO:0000269|PubMed:18423020, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:22762281}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN43150.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0948856e-81BT094885.1 Soybean clone JCVI-FLGm-6I20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003554728.12e-31single-stranded DNA-binding protein WHY2, mitochondrial
RefseqXP_028216373.12e-31single-stranded DNA-binding protein WHY2, mitochondrial-like
SwissprotQ8VYF79e-23WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA0A445FLA43e-31A0A445FLA4_GLYSO; Single-stranded DNA-binding protein WHY2, mitochondrial isoform B
STRINGGLYMA19G43880.21e-30(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF113833338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.18e-19WHIRLY 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]