PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN43823.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

MYB_related

Protein Properties

Length: 60aa MW: 6987.05 Da PI: 11.0885

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN43823.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	35.7	2e-11	4	40	11	47
HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 l++++ + +G+g+Wk Iar+ k+Rt q+ s+ qky KHN43823.1 4 LFLQGLAIYGKGDWKNIARYAVKTRTSTQVASHAQKY 40 79**********************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	13.116	1	45	IPR017930	Myb domain
CDD	cd00167	4.12E-7	3	41	No hit	No description
TIGRFAMs	TIGR01557	1.8E-11	3	43	IPR006447	Myb domain, plants
SuperFamily	SSF46689	3.04E-12	3	45	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.1E-6	4	40	IPR009057	Homeodomain-like
Pfam	PF00249	3.7E-8	4	40	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 60 aa Download sequence Send to blast
HYRLFLQGLA IYGKGDWKNI ARYAVKTRTS TQVASHAQKY FLHLRASNKK GKRKSIYDTT

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269\|PubMed:26243618}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN43823.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:26243618}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006605600.1	2e-34	myb-like protein J
Swissprot	Q9FNN6	9e-19	SRM1_ARATH; Transcription factor SRM1
TrEMBL	A0A0B2PKU2	9e-36	A0A0B2PKU2_GLYSO; Transcription factor MYB1R1 (Fragment)
STRING	XP_008806104.1	7e-22	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF20197	2	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09450.1	1e-21	MYB_related family protein

Publications ? help Back to Top
Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933] Wang T, et al. Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1027-41 [PMID:26243618] Chen YS, et al. Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis. Plant Mol. Biol., 2017. 93(3): p. 299-311 [PMID:27866313]