PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN44912.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

NAC

Protein Properties

Length: 106aa MW: 12166.1 Da PI: 11.055

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN44912.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	99.3	5.4e-31	5	77	54	128
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +ekewyfF++rd+ky++g+r+nr++ +gyWkatg dk+v + + vg+kk Lvfy g+apkg+kt+W+mheyrl KHN44912.1 5 GEKEWYFFTPRDRKYPNGSRPNRSAGTGYWKATGADKPVGK--PKPVGIKKALVFYAGKAPKGVKTNWIMHEYRL 77 579**********************************98..789*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	35.531	1	95	IPR003441	NAC domain
SuperFamily	SSF101941	4.18E-32	3	80	IPR003441	NAC domain
Pfam	PF02365	1.4E-15	9	77	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MALYGEKEWY FFTPRDRKYP NGSRPNRSAG TGYWKATGAD KPVGKPKPVG IKKALVFYAG 60 KAPKGVKTNW IMHEYRLADV DRSVRKKNSL RVYTSMRPFF SSLSRT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	3e-40	2	77	64	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that positively regulates age-dependent senescence, dark-induced leaf senescence and stress-induced senescence. Regulates leaf senescence through the modulation of the expression of senescence-associated genes SGR1/NYE1, SAG113 and SAUR36/SAG201, which are involved in chlorophyll degradation, and abscisic acid (ABA) and auxin promotion of senescence, respectively. Promotes reactive oxygen species (ROS) production during age-dependent and stress-induced senescence. Regulates positively auxin-mediated responses in roots (PubMed:27388337). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN44912.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) (PubMed:26518251). Induced by salinity and osmotic stress, and during leaf senescence (PubMed:27388337). {ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU661919	1e-179	EU661919.1 Glycine max NAC domain protein (NAC19) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028197842.1	4e-61	NAC domain-containing protein 2-like
Swissprot	Q9CAR0	3e-57	NAC32_ARATH; NAC transcription factor 32
TrEMBL	A0A0B2SKV2	1e-71	A0A0B2SKV2_GLYSO; NAC domain-containing protein 48
TrEMBL	B2ZGR2	3e-71	B2ZGR2_SOYBN; NAC domain protein (Fragment)
STRING	GLYMA02G26480.1	2e-60	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2416	29	81

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G77450.1	2e-48	NAC domain containing protein 32

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933] Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress. Plant Cell, 2014. 26(12): p. 4656-79 [PMID:25549671] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Mahmood K,El-Kereamy A,Kim SH,Nambara E,Rothstein SJ ANAC032 Positively Regulates Age-Dependent and Stress-Induced Senescence in Arabidopsis thaliana. Plant Cell Physiol., 2016. 57(10): p. 2029-2046 [PMID:27388337] Allu AD,Brotman Y,Xue GP,Balazadeh S Transcription factor ANAC032 modulates JA/SA signalling in response to Pseudomonas syringae infection. EMBO Rep., 2016. 17(11): p. 1578-1589 [PMID:27632992] Mahmood K,Xu Z,El-Kereamy A,Casaretto JA,Rothstein SJ The Arabidopsis Transcription Factor ANAC032 Represses Anthocyanin Biosynthesis in Response to High Sucrose and Oxidative and Abiotic Stresses. Front Plant Sci, 2016. 7: p. 1548 [PMID:27790239] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239]