PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KHN47410.1

Organism

Glycine soja

Taxonomic ID

3848

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

NAC

Protein Properties

Length: 177aa MW: 20698.7 Da PI: 9.6374

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KHN47410.1	genome	TCUHK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	157.6	5.2e-49	13	140	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 lppGfrFhP deel+v+yL++kv++++l++ ++i+e+d+y+++Pw+Lp+k+ +e+ewyfF++rd ky++g r+nra++s+yWkatg++k+++++ + + KHN47410.1 13 LPPGFRFHPFDEELIVHYLRNKVTSSPLPA-SFIAEIDLYNYNPWELPSKALFGEDEWYFFTPRDMKYPKGVRPNRAAASSYWKATGTNKPIFTScGMK 110 79**************************.89***********87778999*********************************997778 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 + + k Lvfykgr pkg+ktdW+mheyrl KHN47410.1 111 SIAVNKALVFYKGRPPKGSKTDWIMHEYRL 140 8*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	4.05E-54	9	145	IPR003441	NAC domain
PROSITE profile	PS51005	51.267	13	162	IPR003441	NAC domain
Pfam	PF02365	7.3E-25	14	140	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 177 aa Download sequence Send to blast
MFMDKDANSE IQLPPGFRFH PFDEELIVHY LRNKVTSSPL PASFIAEIDL YNYNPWELPS 60 KALFGEDEWY FFTPRDMKYP KGVRPNRAAA SSYWKATGTN KPIFTSCGMK SIAVNKALVF 120 YKGRPPKGSK TDWIMHEYRL HDSMISNSKQ GGSMRVGQFH EFNFSIWWFL MTNRVNY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	1e-59	1	140	3	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:16640597, ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:22184656, ECO:0000269\|PubMed:25516602}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KHN47410.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269\|PubMed:22184656, ECO:0000269\|PubMed:24659488, ECO:0000269\|PubMed:25516602, ECO:0000269\|PubMed:9489703}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC235460	0.0	AC235460.1 Glycine max strain Williams 82 clone GM_WBb0169H15, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006593180.1	1e-112	NAC transcription factor 29
Swissprot	O49255	1e-70	NAC29_ARATH; NAC transcription factor 29
TrEMBL	A0A0B2SR85	1e-130	A0A0B2SR85_GLYSO; NAC domain-containing protein 29
STRING	GLYMA12G21272.1	1e-111	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2416	29	81

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69490.1	6e-73	NAC-like, activated by AP3/PI

Publications ? help Back to Top
Zhang K,Gan SS An abscisic acid-AtNAP transcription factor-SAG113 protein phosphatase 2C regulatory chain for controlling dehydration in senescing Arabidopsis leaves. Plant Physiol., 2012. 158(2): p. 961-9 [PMID:22184656] Zhang K,Halitschke R,Yin C,Liu CJ,Gan SS Salicylic acid 3-hydroxylase regulates Arabidopsis leaf longevity by mediating salicylic acid catabolism. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(36): p. 14807-12 [PMID:23959884] Shinozaki Y, et al. Expression of an AtNAP gene homolog in senescing morning glory (Ipomoea nil) petals of two cultivars with a different flower life span. J. Plant Physiol., 2014. 171(8): p. 633-8 [PMID:24709156] Qi X, et al. Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing. Nat Commun, 2014. 5: p. 4340 [PMID:25004933] Xiao D, et al. SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription. Plant Cell Rep., 2016. 35(1): p. 155-66 [PMID:26441053] Seok HY, et al. Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response. Planta, 2017. 245(2): p. 329-341 [PMID:27770200]