| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | GRAS | 40.6 | 4e-13 | 129 | 205 | 3 | 80 |
GRAS 3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaa 80
+ Lle A+av+++++++ q+l++ l++l+sp++d+ q+la+yf++ +++++ ++++yk+l++ ++++ s ++++
KHN48375.1 129 DILLETARAVADKNTTRLQQLMWMLNKLSSPYDDTDQKLASYFLQTFFSHITQAGDRTYKTLASASKKT-CSFKSTHK 205
689**********************************************************98777763.33334444 PP
|
| 2 | GRAS | 30.1 | 6.2e-10 | 230 | 296 | 241 | 308 |
GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrer 308
++ ++ +++ +F+++f e+l+++ + f++l+ +pr+s+e ++Ere gr+ v++vac+ e++er
KHN48375.1 230 EADLDIGLEGFEFVKGFEECLRWFRVYFEALDRIFPRTSNEHLMLERE-AGRAMVDLVACSLVESVER 296
444455566779************************************.************9998887 PP
|
| Publications
? help Back to Top |
- Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Muraro D, et al.
Integration of hormonal signaling networks and mobile microRNAs is required for vascular patterning in Arabidopsis roots.
Proc. Natl. Acad. Sci. U.S.A., 2014. 111(2): p. 857-62
[PMID:24381155] - Tian H,Jia Y,Niu T,Yu Q,Ding Z
The key players of the primary root growth and development also function in lateral roots in Arabidopsis.
Plant Cell Rep., 2014. 33(5): p. 745-53
[PMID:24504658] - Gao X,Wang C,Cui H
Identification of bundle sheath cell fate factors provides new tools for C3-to-C4 engineering.
Plant Signal Behav, 2018.
[PMID:24819776] - Qi X, et al.
Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
Nat Commun, 2014. 5: p. 4340
[PMID:25004933] - Ahrazem O, et al.
Ectopic expression of a stress-inducible glycosyltransferase from saffron enhances salt and oxidative stress tolerance in Arabidopsis while alters anchor root formation.
Plant Sci., 2015. 234: p. 60-73
[PMID:25804810] - Jia Y, et al.
The Arabidopsis thaliana elongator complex subunit 2 epigenetically affects root development.
J. Exp. Bot., 2015. 66(15): p. 4631-42
[PMID:25998905] - Zhang M, et al.
A tetratricopeptide repeat domain-containing protein SSR1 located in mitochondria is involved in root development and auxin polar transport in Arabidopsis.
Plant J., 2015. 83(4): p. 582-99
[PMID:26072661] - Moreno-Risueno MA, et al.
Transcriptional control of tissue formation throughout root development.
Science, 2015. 350(6259): p. 426-30
[PMID:26494755] - Miguel A,Milhinhos A,Novák O,Jones B,Miguel CM
The SHORT-ROOT-like gene PtSHR2B is involved in Populus phellogen activity.
J. Exp. Bot., 2016. 67(5): p. 1545-55
[PMID:26709311] - Gong X, et al.
SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
Plant Physiol., 2016. 170(3): p. 1675-83
[PMID:26818732] - Kim ES, et al.
HAWAIIAN SKIRT regulates the quiescent center-independent meristem activity in Arabidopsis roots.
Physiol Plant, 2016. 157(2): p. 221-33
[PMID:26968317] - Lee SA, et al.
Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
Mol Plant, 2016. 9(6): p. 870-84
[PMID:26970019] - Li Q,Zhao Y,Yue M,Xue Y,Bao S
The Protein Arginine Methylase 5 (PRMT5/SKB1) Gene Is Required for the Maintenance of Root Stem Cells in Response to DNA Damage.
J Genet Genomics, 2016. 43(4): p. 187-97
[PMID:27090604] - Clark NM, et al.
Tracking transcription factor mobility and interaction in Arabidopsis roots with fluorescence correlation spectroscopy.
Elife, 2017.
[PMID:27288545] - Yoon EK, et al.
Conservation and Diversification of the SHR-SCR-SCL23 Regulatory Network in the Development of the Functional Endodermis in Arabidopsis Shoots.
Mol Plant, 2016. 9(8): p. 1197-1209
[PMID:27353361] - Waszczak C, et al.
SHORT-ROOT Deficiency Alleviates the Cell Death Phenotype of the Arabidopsis catalase2 Mutant under Photorespiration-Promoting Conditions.
Plant Cell, 2016. 28(8): p. 1844-59
[PMID:27432873] - Yu Q, et al.
A P-Loop NTPase Regulates Quiescent Center Cell Division and Distal Stem Cell Identity through the Regulation of ROS Homeostasis in Arabidopsis Root.
PLoS Genet., 2016. 12(9): p. e1006175
[PMID:27583367] - Sparks EE, et al.
Establishment of Expression in the SHORTROOT-SCARECROW Transcriptional Cascade through Opposing Activities of Both Activators and Repressors.
Dev. Cell, 2016. 39(5): p. 585-596
[PMID:27923776] - Hirano Y, et al.
Structure of the SHR-SCR heterodimer bound to the BIRD/IDD transcriptional factor JKD.
Nat Plants, 2017. 3: p. 17010
[PMID:28211915] - Henry S, et al.
SHR overexpression induces the formation of supernumerary cell layers with cortex cell identity in rice.
Dev. Biol., 2017. 425(1): p. 1-7
[PMID:28263767] - Möller BK, et al.
Auxin response cell-autonomously controls ground tissue initiation in the early Arabidopsis embryo.
Proc. Natl. Acad. Sci. U.S.A., 2017. 114(12): p. E2533-E2539
[PMID:28265057] - Kobayashi A,Miura S,Kozaki A
INDETERMINATE DOMAIN PROTEIN binding sequences in the 5'-untranslated region and promoter of the SCARECROW gene play crucial and distinct roles in regulating SCARECROW expression in roots and leaves.
Plant Mol. Biol., 2017. 94(1-2): p. 1-13
[PMID:28324206] - Díaz-Triviño S,Long Y,Scheres B,Blilou I
Analysis of a Plant Transcriptional Regulatory Network Using Transient Expression Systems.
Methods Mol. Biol., 2017. 1629: p. 83-103
[PMID:28623581] - Long Y, et al.
In vivo FRET-FLIM reveals cell-type-specific protein interactions in Arabidopsis roots.
Nature, 2017. 548(7665): p. 97-102
[PMID:28746306] - Yu Q, et al.
Cell-Fate Specification in Arabidopsis Roots Requires Coordinative Action of Lineage Instruction and Positional Reprogramming.
Plant Physiol., 2017. 175(2): p. 816-827
[PMID:28821591] - Spiegelman Z,Lee CM,Gallagher KL
KinG Is a Plant-Specific Kinesin That Regulates Both Intra- and Intercellular Movement of SHORT-ROOT.
Plant Physiol., 2018. 176(1): p. 392-405
[PMID:29122988] - Bustillo-Avendaño E, et al.
Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
Plant Physiol., 2018. 176(2): p. 1709-1727
[PMID:29233938]
|
