![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KHN48833.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | BES1 | ||||||||
| Protein Properties | Length: 92aa MW: 10643.2 Da PI: 11.2992 | ||||||||
| Description | BES1 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF822 | 111.3 | 1.6e-34 | 12 | 73 | 3 | 64 |
DUF822 3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvved 64
s+rk +w++rEnnkrRERrRRaiaakiy+GL aqGn++lpk+ Dnn+ lkALc+ AGw v++
KHN48833.1 12 SQRKASWRDRENNKRRERRRRAIAAKIYSGLQAQGNFNLPKHHDNNKTLKALCTKAGWCVKE 73
789*********************************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF05687 | 4.7E-31 | 12 | 73 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 92 aa Download sequence Send to blast |
MADDGATLTR MSQRKASWRD RENNKRRERR RRAIAAKIYS GLQAQGNFNL PKHHDNNKTL 60 KALCTKAGWC VKEAWLRVDG GGTVEKEKKR MM |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5zd4_A | 1e-15 | 13 | 73 | 371 | 431 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_B | 1e-15 | 13 | 73 | 371 | 431 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_C | 1e-15 | 13 | 73 | 371 | 431 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_D | 1e-15 | 13 | 73 | 371 | 431 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Positive regulator of brassinosteroid (BR) signaling. Transcription factor that activates target gene expression by binding specifically to the DNA sequence 5'-CANNTG-3'(E box) through its N-terminal domain. Can bind individually to the promoter as a homodimer or synergistically as a heterodimer with BIM1, BIM2 or BIM3. The C-terminal domain is probably involved in transcriptional activation (PubMed:12007405, PubMed:15680330, PubMed:18467490, PubMed:19170933). Recruits the transcription elongation factor IWS1 to control BR-regulated gene expression (PubMed:20139304). Forms a trimeric complex with IWS1 and ASHH2/SDG8 to regulate BR-regulated gene expression (PubMed:24838002). Promotes quiescent center (QC) self-renewal by cell divisions in the primary root. Binds to the E-boxes of the BRAVO promoter to repress its expression (PubMed:24981610). {ECO:0000269|PubMed:12007405, ECO:0000269|PubMed:15680330, ECO:0000269|PubMed:18467490, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20139304, ECO:0000269|PubMed:24838002, ECO:0000269|PubMed:24981610}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KHN48833.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006601311.1 | 6e-24 | protein BRASSINAZOLE-RESISTANT 1 | ||||
| Refseq | XP_028211484.1 | 6e-24 | protein BRASSINAZOLE-RESISTANT 1-like | ||||
| Swissprot | Q9LN63 | 1e-17 | BZR2_ARATH; Protein BRASSINAZOLE-RESISTANT 2 | ||||
| TrEMBL | A0A0B2SV88 | 3e-61 | A0A0B2SV88_GLYSO; Protein BRASSINAZOLE-RESISTANT 2 | ||||
| STRING | GLYMA17G36730.1 | 2e-23 | (Glycine max) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G19350.6 | 2e-15 | BES1 family protein | ||||




