![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KN538682.1_FGP215 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 81aa MW: 9303.47 Da PI: 6.3344 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 31.4 | 4.4e-10 | 14 | 43 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30
rg W++eEde+l+++++ +G g+W+ ++++
KN538682.1_FGP215 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEK 43
789************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 3.7E-14 | 6 | 43 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50090 | 7.039 | 9 | 43 | IPR017877 | Myb-like domain |
| SuperFamily | SSF46689 | 8.28E-9 | 10 | 43 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 7.6E-8 | 14 | 43 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.11E-6 | 17 | 43 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 81 aa Download sequence Send to blast |
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAVHCNID LTIDNPVSDT 60 SHDKTDMKFP QKIIKGDSEV F |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KN538682.1_FGP215 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK111808 | 9e-68 | AK111808.1 Oryza sativa Japonica Group cDNA clone:J013114D05, full insert sequence. | |||
| GenBank | AK112117 | 9e-68 | AK112117.1 Oryza sativa Japonica Group cDNA clone:002-129-C03, full insert sequence. | |||
| GenBank | AP004461 | 9e-68 | AP004461.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0443G08. | |||
| GenBank | AP014964 | 9e-68 | AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence. | |||
| GenBank | CP012616 | 9e-68 | CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019151107.1 | 2e-26 | PREDICTED: transcription factor MYB46-like | ||||
| Swissprot | Q9SPG3 | 5e-20 | MYB26_ARATH; Transcription factor MYB26 | ||||
| TrEMBL | A0A0C6WCT0 | 4e-25 | A0A0C6WCT0_9POAL; ScMYB7 protein | ||||
| TrEMBL | A0A453RYN4 | 3e-25 | A0A453RYN4_AEGTS; Uncharacterized protein | ||||
| STRING | Pavir.Fb00364.1.p | 8e-26 | (Panicum virgatum) | ||||
| STRING | XP_010054774.1 | 2e-25 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP6032 | 37 | 57 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G63910.1 | 2e-28 | myb domain protein 103 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




