![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KN538889.1_FGP017 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 148aa MW: 16040 Da PI: 4.8383 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 174.9 | 7.9e-55 | 29 | 124 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
reqdr++Pianv+rim++vlPa+akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa++ lGf+dyvepl+vyl++yre+
KN538889.1_FGP017 29 REQDRLMPIANVIRIMRRVLPAHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSRLGFDDYVEPLSVYLHRYREF 120
89****************************************************************************************** PP
NF-YB 94 egek 97
ege+
KN538889.1_FGP017 121 EGES 124
*986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.0E-49 | 22 | 125 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.55E-38 | 31 | 127 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.3E-25 | 35 | 98 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.3E-17 | 62 | 80 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 65 | 81 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.3E-17 | 81 | 99 | No hit | No description |
| PRINTS | PR00615 | 2.3E-17 | 100 | 118 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0033613 | Molecular Function | activating transcription factor binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 148 aa Download sequence Send to blast |
MEAGYPGAAN GAAAADGNGG AQQAAPAIRE QDRLMPIANV IRIMRRVLPA HAKISDDAKE 60 TIQECVSEYI SFITGEANER CQREQRKTIT AEDVLWAMSR LGFDDYVEPL SVYLHRYREF 120 EGESRGVGVG VGVGAGCEAG GSDRSMRF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 5e-62 | 27 | 119 | 5 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KN538889.1_FGP017 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY264284 | 0.0 | AY264284.1 Oryza sativa (indica cultivar-group) leafy cotyledon 1 gene, complete cds. | |||
| GenBank | CP012610 | 0.0 | CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002452627.2 | 1e-73 | nuclear transcription factor Y subunit B-2 | ||||
| Swissprot | Q84W66 | 1e-64 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | A0A0E0CQW8 | 2e-73 | A0A0E0CQW8_9ORYZ; Uncharacterized protein | ||||
| TrEMBL | B6UH02 | 2e-73 | B6UH02_MAIZE; Nuclear transcription factor Y subunit B-6 | ||||
| STRING | OMERI02G28980.1 | 3e-74 | (Oryza meridionalis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 1e-60 | nuclear factor Y, subunit B6 | ||||




