![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KN538899.1_FGP013 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 59aa MW: 6791.67 Da PI: 4.3999 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 57.3 | 5.3e-18 | 11 | 57 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
+ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd++
KN538899.1_FGP013 11 VPPGFRFHPTEEELLNYYLRKKVASEQIDL-DVIRDVDLNKLEPWDIQ 57
69****************************.9**************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 4.05E-18 | 7 | 58 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 20.317 | 11 | 59 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.2E-8 | 12 | 54 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 59 aa Download sequence Send to blast |
MSISVNGQSC VPPGFRFHPT EEELLNYYLR KKVASEQIDL DVIRDVDLNK LEPWDIQGS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KN538899.1_FGP013 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP004562 | 6e-93 | AP004562.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0470F10. | |||
| GenBank | AP005657 | 6e-93 | AP005657.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0427G12. | |||
| GenBank | AP014964 | 6e-93 | AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015648974.1 | 1e-35 | NAC domain-containing protein 43 | ||||
| Refseq | XP_015695478.1 | 4e-36 | PREDICTED: NAC domain-containing protein 43-like | ||||
| Swissprot | Q84WP6 | 2e-29 | NAC43_ARATH; NAC domain-containing protein 43 | ||||
| TrEMBL | A0A0E0I6L0 | 8e-35 | A0A0E0I6L0_ORYNI; Uncharacterized protein | ||||
| TrEMBL | B8BA72 | 1e-36 | B8BA72_ORYSI; Uncharacterized protein | ||||
| TrEMBL | B8BA74 | 1e-35 | B8BA74_ORYSI; Uncharacterized protein | ||||
| TrEMBL | Q6YXS5 | 1e-35 | Q6YXS5_ORYSJ; Os08g0115800 protein | ||||
| STRING | OGLUM08G01180.1 | 4e-35 | (Oryza glumipatula) | ||||
| STRING | OS08T0115800-01 | 2e-36 | (Oryza sativa) | ||||
| STRING | ONIVA08G01130.1 | 1e-35 | (Oryza nivara) | ||||
| STRING | OPUNC08G01110.1 | 3e-35 | (Oryza punctata) | ||||
| STRING | ORGLA08G0004900.1 | 4e-35 | (Oryza glaberrima) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP16506 | 9 | 13 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G46770.1 | 9e-32 | NAC family protein | ||||




