![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KN538915.1_FGP017 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 94aa MW: 10969.6 Da PI: 10.77 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 99.6 | 4.4e-31 | 5 | 79 | 54 | 128 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
+ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + +++++ +glkktLvfy+g+apkg++++W+m+eyrl
KN538915.1_FGP017 5 GEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRAENNRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 79
789**********************************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 33.64 | 1 | 94 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 1.57E-32 | 3 | 85 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.3E-13 | 9 | 79 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 94 aa Download sequence Send to blast |
MAAIGEKEWF FYVPRDRKYR NGDRPNRVTA SGYWKATGAD RMIRAENNRP IGLKKTLVFY 60 SGKAPKGVRS SWIMNEYRLP PADTDRYHKV PIHP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 9e-33 | 2 | 79 | 66 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 9e-33 | 2 | 79 | 66 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 9e-33 | 2 | 79 | 66 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 9e-33 | 2 | 79 | 66 | 142 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
| 3swm_B | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
| 3swm_C | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
| 3swm_D | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
| 3swp_A | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
| 3swp_B | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
| 3swp_C | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
| 3swp_D | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
| 4dul_A | 9e-33 | 2 | 79 | 66 | 142 | NAC domain-containing protein 19 |
| 4dul_B | 9e-33 | 2 | 79 | 66 | 142 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KN538915.1_FGP017 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP003346 | 1e-151 | AP003346.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0434C04. | |||
| GenBank | AP003431 | 1e-151 | AP003431.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1099D03. | |||
| GenBank | AP014957 | 1e-151 | AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence. | |||
| GenBank | CP012609 | 1e-151 | CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015695832.1 | 2e-59 | PREDICTED: NAC transcription factor ONAC010 | ||||
| Swissprot | Q9ZVP8 | 2e-51 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
| TrEMBL | A0A0D9V8R6 | 2e-58 | A0A0D9V8R6_9ORYZ; Uncharacterized protein | ||||
| STRING | LPERR01G34330.2 | 3e-59 | (Leersia perrieri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2826 | 37 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G02450.2 | 1e-53 | NAC domain containing protein 35 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




