PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KN539033.1_FGP003

Organism

Oryza longistaminata

Taxonomic ID

4528

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

NAC

Protein Properties

Length: 153aa MW: 17034.9 Da PI: 9.3193

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KN539033.1_FGP003	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	106.8	2.7e-33	21	93	55	128
NAM 55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++s +++ +g++ktLvfykgrap+g+k+dW+mheyrl KN539033.1_FGP003 21 QNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYS-SSNRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 93 579***********************************.9999*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	33.406	1	133	IPR003441	NAC domain
SuperFamily	SSF101941	8.24E-34	19	100	IPR003441	NAC domain
Pfam	PF02365	2.2E-16	22	93	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 153 aa Download sequence Send to blast
MWHVCTIHTY AERCRIGSGP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKAIYS 60 SSNRIGMRKT LVFYKGRAPH GQKSDWIMHE YRLDDPSSAS ASVSVNLPSY YSSSSSSSSP 120 EEDDKLAFEL AMAITVSSLA QLVGNLASDF NSS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-30	21	106	70	155	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-30	21	106	70	155	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-30	21	106	70	155	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-30	21	106	70	155	NO APICAL MERISTEM PROTEIN
3swm_A	2e-30	21	106	73	158	NAC domain-containing protein 19
3swm_B	2e-30	21	106	73	158	NAC domain-containing protein 19
3swm_C	2e-30	21	106	73	158	NAC domain-containing protein 19
3swm_D	2e-30	21	106	73	158	NAC domain-containing protein 19
3swp_A	2e-30	21	106	73	158	NAC domain-containing protein 19
3swp_B	2e-30	21	106	73	158	NAC domain-containing protein 19
3swp_C	2e-30	21	106	73	158	NAC domain-containing protein 19
3swp_D	2e-30	21	106	73	158	NAC domain-containing protein 19
4dul_A	2e-30	21	106	70	155	NAC domain-containing protein 19
4dul_B	2e-30	21	106	70	155	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269\|PubMed:16214898, ECO:0000269\|PubMed:17237351, ECO:0000269\|PubMed:17333250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KN539033.1_FGP003

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP012614	0.0	CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015643041.1	3e-74	NAC domain-containing protein 43
Swissprot	Q84WP6	3e-53	NAC43_ARATH; NAC domain-containing protein 43
TrEMBL	A0A0D3GCE0	7e-74	A0A0D3GCE0_9ORYZ; Uncharacterized protein
STRING	ORUFI06G01950.1	1e-73	(Oryza rufipogon)
STRING	OS06T0131700-01	1e-73	(Oryza sativa)
STRING	ORGLA06G0019800.1	1e-73	(Oryza glaberrima)
STRING	OBART06G01950.1	1e-74	(Oryza barthii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1597	38	112

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G46770.1	3e-41	NAC family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Gondolf VM, et al. A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis. BMC Plant Biol., 2014. 14: p. 344 [PMID:25492673] Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons. GM Crops Food, 2014. 5(4): p. 302-20 [PMID:25523176] Yuan Y,Teng Q,Zhong R,Ye ZH TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan. Plant Cell Physiol., 2016. 57(1): p. 35-45 [PMID:26556650] Yang C, et al. Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation. Plant Physiol., 2017. 175(1): p. 333-350 [PMID:28724622] Pascual MB, et al. PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine. Plant Biotechnol. J., 2018. 16(5): p. 1094-1104 [PMID:29055073] Liu C,Yu H,Li L SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana. PLoS Genet., 2019. 15(1): p. e1007928 [PMID:30657769]