![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KN539217.1_FGP001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 66aa MW: 7023.9 Da PI: 3.993 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 37 | 7.9e-12 | 34 | 65 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32
rg+WT eEd llvd+++ +G g+W++ ar+ g
KN539217.1_FGP001 34 RGPWTVEEDMLLVDYIANHGEGRWNSLARCAG 65
89***************************998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 12.276 | 29 | 66 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 5.46E-9 | 31 | 64 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.9E-11 | 32 | 65 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 4.4E-9 | 34 | 66 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 8.59E-7 | 36 | 66 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
MEMEMMGMAM SPAMSSATAA AAAAASEDEG DLRRGPWTVE EDMLLVDYIA NHGEGRWNSL 60 ARCAGT |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KN539217.1_FGP001 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC118288 | 1e-69 | AC118288.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0077L08, complete sequence. | |||
| GenBank | AK243659 | 1e-69 | AK243659.1 Oryza sativa Japonica Group cDNA, clone: J100089B08, full insert sequence. | |||
| GenBank | AP014961 | 1e-69 | AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence. | |||
| GenBank | CP012613 | 1e-69 | CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015638460.1 | 1e-23 | transcription factor MYB2-like | ||||
| Swissprot | Q10MB4 | 1e-16 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
| TrEMBL | A0A0E0KY62 | 1e-35 | A0A0E0KY62_ORYPU; Uncharacterized protein | ||||
| STRING | OPUNC05G02190.1 | 2e-36 | (Oryza punctata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP27133 | 4 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G49620.2 | 2e-16 | myb domain protein 78 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




