![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KN539363.1_FGP005 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 117aa MW: 12780.6 Da PI: 9.5113 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 100.7 | 5.5e-32 | 51 | 101 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyeys+
KN539363.1_FGP005 51 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSN 101
79***********************************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 32.282 | 43 | 103 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.1E-39 | 43 | 102 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.52E-39 | 45 | 102 | No hit | No description |
| PRINTS | PR00404 | 1.9E-33 | 45 | 65 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 45 | 99 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.44E-29 | 45 | 103 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.5E-27 | 52 | 99 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.9E-33 | 65 | 80 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.9E-33 | 80 | 101 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 117 aa Download sequence Send to blast |
MHIYKEQEAE PSTGLMMPEP APAASPGSGG SGGSGLVGAE KIGSRGKIEI KRIENTTNRQ 60 VTFCKRRNGL LKKAYELSVL CDAEVALVVF SSRGRLYEYS NNRYCIPLPL FSSRNLN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 1e-19 | 45 | 101 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 1e-19 | 45 | 101 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 1e-19 | 45 | 101 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 1e-19 | 45 | 101 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 3mu6_A | 1e-19 | 45 | 102 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 1e-19 | 45 | 102 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 1e-19 | 45 | 102 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 1e-19 | 45 | 102 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 6c9l_A | 1e-19 | 45 | 101 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 1e-19 | 45 | 101 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 1e-19 | 45 | 101 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 1e-19 | 45 | 101 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 1e-19 | 45 | 101 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 1e-19 | 45 | 101 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269|PubMed:16326928}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KN539363.1_FGP005 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB232157 | 1e-155 | AB232157.1 Oryza sativa Japonica Group mRNA for transcription factor OsMADS58, complete cds. | |||
| GenBank | AK111723 | 1e-155 | AK111723.1 Oryza sativa Japonica Group cDNA clone:J023027E19, full insert sequence. | |||
| GenBank | FJ750942 | 1e-155 | FJ750942.1 Oryza sativa clone KCS268A08 MADS-box transcription factor 58 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015638060.1 | 2e-53 | MADS-box transcription factor 58 isoform X1 | ||||
| Refseq | XP_025881631.1 | 6e-54 | MADS-box transcription factor 58 isoform X2 | ||||
| Swissprot | Q2V0P1 | 8e-56 | MAD58_ORYSJ; MADS-box transcription factor 58 | ||||
| TrEMBL | A0A0E0DN63 | 2e-66 | A0A0E0DN63_9ORYZ; Uncharacterized protein | ||||
| STRING | OMERI05G05690.1 | 6e-67 | (Oryza meridionalis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58780.2 | 1e-37 | MIKC_MADS family protein | ||||




