PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KN539371.1_FGP014

Organism

Oryza longistaminata

Taxonomic ID

4528

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

bZIP

Protein Properties

Length: 199aa MW: 22544.5 Da PI: 8.4847

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KN539371.1_FGP014	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	31.3	4.5e-10	47	104	5	62
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 kr +r NR +A rs +R+ +i+eLe+kv+ L++e ++L +l l+ ++ + ++ KN539371.1_FGP014 47 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSSGMATQ 104 999******************************************9999887776665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	3.0E-16	43	107	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.565	45	108	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	9.0E-11	47	103	No hit	No description
SuperFamily	SSF57959	4.22E-11	47	97	No hit	No description
Pfam	PF00170	1.1E-9	47	105	IPR004827	Basic-leucine zipper domain
CDD	cd14703	2.36E-18	48	97	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 199 aa Download sequence Send to blast
MGKLSFAANG EPAKFSLEFG SGEFTPAEMK RIMADEKLAE MALADPKRVK RVLANRQSAA 60 RSKERRMRYI AELEQKVQIL QTEATTLSAQ LTLLQRDSSG MATQNNELKF RLQSMEQQAQ 120 LRDALNEALT AEVQRLKLAA NEVGDTSSSS NLAHQIQLRC QNQMLDLHKQ QQQQVEQIPF 180 YQLEQPEQQN GTARNHESK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269\|PubMed:11390974, ECO:0000269\|PubMed:12855676, ECO:0000269\|PubMed:14704272, ECO:0000269\|PubMed:9311985}.
UniProt	Transcrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269\|PubMed:27896439}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KN539371.1_FGP014

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK108607	0.0	AK108607.1 Oryza sativa Japonica Group cDNA clone:002-146-H05, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015613793.1	1e-137	transcription factor RF2a-like isoform X1
Swissprot	O22873	3e-49	BZP18_ARATH; bZIP transcription factor 18
Swissprot	Q69IL4	5e-49	RF2A_ORYSJ; Transcription factor RF2a
TrEMBL	Q8LN44	1e-136	Q8LN44_ORYSJ; BZIP transcription factor family protein, expressed
STRING	OS10T0531900-01	1e-137	(Oryza sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3536	35	76

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38900.3	2e-53	bZIP family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Dai S,Zhang Z,Bick J,Beachy RN Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus. J. Gen. Virol., 2006. 87(Pt 3): p. 715-22 [PMID:16476995] Liu Y,Dai S,Beachy RN Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription. Biochem. J., 2007. 405(2): p. 243-9 [PMID:17371296] Dai S, et al. Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease. Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6 [PMID:19104064] Ordiz MI,Yang J,Barbazuk WB,Beachy RN Functional analysis of the activation domain of RF2a, a rice transcription factor. Plant Biotechnol. J., 2010. 8(7): p. 835-44 [PMID:20408988] Pawar V, et al. A novel family of plant nuclear envelope-associated proteins. J. Exp. Bot., 2016. 67(19): p. 5699-5710 [PMID:27630107] Gibalová A, et al. Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte. Plant Reprod, 2017. 30(1): p. 1-17 [PMID:27896439] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S Efficient gene tagging in Arabidopsis thaliana using a gene trap approach. Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7 [PMID:9356517]