![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KN539405.1_FGP007 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 51aa MW: 5750.46 Da PI: 7.442 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 39.3 | 1.5e-12 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32
+g+WT+eEd++l+ +++q+G g+W++ +++ g
KN539405.1_FGP007 14 KGPWTPEEDQKLLAYIEQHGHGCWRSLPSKAG 45
79*************************99998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 7.1E-16 | 5 | 46 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 4.56E-10 | 9 | 45 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 15.343 | 9 | 51 | IPR017930 | Myb domain |
| Pfam | PF00249 | 3.4E-10 | 14 | 45 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 4.55E-7 | 16 | 45 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 51 aa Download sequence Send to blast |
MGRSPCCEKE GLKKGPWTPE EDQKLLAYIE QHGHGCWRSL PSKAGQEHTS Q |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KN539405.1_FGP007 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AL606460 | 4e-69 | AL606460.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0072F16, complete sequence. | |||
| GenBank | AP014960 | 4e-69 | AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence. | |||
| GenBank | CP012612 | 4e-69 | CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence. | |||
| GenBank | CR855203 | 4e-69 | CR855203.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: H0219H12, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015635111.1 | 2e-25 | transcription factor MYB106 | ||||
| Refseq | XP_015691484.1 | 8e-26 | PREDICTED: transcription factor MYB32-like | ||||
| Swissprot | Q9LE63 | 3e-23 | MY106_ARATH; Transcription factor MYB106 | ||||
| TrEMBL | B9FFJ6 | 4e-25 | B9FFJ6_ORYSJ; Uncharacterized protein | ||||
| STRING | ORUFI04G16390.1 | 7e-25 | (Oryza rufipogon) | ||||
| STRING | OS04T0461000-01 | 7e-25 | (Oryza sativa) | ||||
| STRING | ONIVA04G13130.1 | 7e-25 | (Oryza nivara) | ||||
| STRING | ORGLA04G0119800.1 | 7e-25 | (Oryza glaberrima) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP229 | 38 | 296 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G15310.1 | 3e-25 | myb domain protein 16 | ||||




