![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KN539494.1_FGP009 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 115aa MW: 12454.2 Da PI: 10.5626 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 73.5 | 4e-23 | 16 | 74 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
F+ k+y+++ed+ ++ +i w + +nsfvv d+ f++++Lp +Fkh+nf+SFvRQLn+Y
KN539494.1_FGP009 16 FVWKTYRMVEDPGTDGVIGWGKGNNSFVVADPFVFSQTLLPAHFKHNNFSSFVRQLNTY 74
9*********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 7.0E-26 | 12 | 79 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 2.0E-21 | 12 | 109 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 2.99E-22 | 15 | 74 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 2.2E-18 | 16 | 74 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 8.7E-13 | 16 | 39 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 8.7E-13 | 54 | 66 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 8.7E-13 | 67 | 79 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
MAAVAAGGGG GGAAPFVWKT YRMVEDPGTD GVIGWGKGNN SFVVADPFVF SQTLLPAHFK 60 HNNFSSFVRQ LNTYVSLVTP SSISSSHHTP PLSALHIMLP WILSGTQLKT WRDRR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5w_B | 2e-17 | 13 | 74 | 1 | 62 | Putative transcription factor |
| 5d5x_B | 2e-17 | 13 | 74 | 1 | 62 | Putative transcription factor |
| 5d5x_E | 2e-17 | 13 | 74 | 1 | 62 | Putative transcription factor |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KN539494.1_FGP009 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK241254 | 1e-165 | AK241254.1 Oryza sativa Japonica Group cDNA, clone: J065130H10, full insert sequence. | |||
| GenBank | AP003682 | 1e-165 | AP003682.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0427B07. | |||
| GenBank | AP014962 | 1e-165 | AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004965592.1 | 2e-39 | heat stress transcription factor C-2b | ||||
| Swissprot | Q0DBL6 | 1e-38 | HFC2B_ORYSJ; Heat stress transcription factor C-2b | ||||
| TrEMBL | A0A0E0AAT1 | 9e-63 | A0A0E0AAT1_9ORYZ; Uncharacterized protein | ||||
| STRING | OGLUM06G19290.1 | 1e-63 | (Oryza glumipatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP4471 | 34 | 70 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G24520.1 | 3e-25 | heat shock transcription factor C1 | ||||




