![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KN539839.1_FGP003 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 88aa MW: 10776.4 Da PI: 10.639 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 49.3 | 1e-15 | 2 | 53 | 5 | 56 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56
+r++r++kNRe+A rsR+RK+a+i+eLe v+eLe+e +L e ee +++
KN539839.1_FGP003 2 QRQKRMIKNRESAARSRERKQAYIAELEAQVAELEEEHAQLLREQEEKNQKR 53
79**************************************998877665554 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50217 | 10.978 | 1 | 48 | IPR004827 | Basic-leucine zipper domain |
| SMART | SM00338 | 7.2E-9 | 1 | 67 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 4.7E-13 | 2 | 52 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 5.3E-14 | 3 | 50 | No hit | No description |
| SuperFamily | SSF57959 | 6.88E-12 | 3 | 49 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 5 | 20 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MQRQKRMIKN RESAARSRER KQAYIAELEA QVAELEEEHA QLLREQEEKN QKRLKEKWHV 60 FMQIKEQAVA VVIRKKTQDL RRTNSMEW |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KN539839.1_FGP003 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CT834109 | 2e-84 | CT834109.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA060C07, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015639395.1 | 2e-44 | bZIP transcription factor 12-like | ||||
| Swissprot | Q0JHF1 | 7e-32 | BZP12_ORYSJ; bZIP transcription factor 12 | ||||
| TrEMBL | A0A0E0HF20 | 2e-56 | A0A0E0HF20_ORYNI; Uncharacterized protein | ||||
| STRING | ONIVA05G18780.2 | 3e-57 | (Oryza nivara) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2665 | 37 | 86 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G03970.1 | 1e-10 | G-box binding factor 4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




