![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KN540497.1_FGP006 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 115aa MW: 13166.2 Da PI: 7.8672 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 50.7 | 4.2e-16 | 20 | 66 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g WT eEde l + v+ +G W+ Ia+ ++ t+kqc++rw ++l
KN540497.1_FGP006 20 KGGWTREEDEVLRQMVRHHGDCKWTEIAKSLP-SQTGKQCRERWTNHL 66
688*****************************.************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 21.803 | 15 | 70 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 7.2E-20 | 15 | 71 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.1E-13 | 19 | 68 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.58E-17 | 20 | 71 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 3.9E-15 | 20 | 66 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.30E-15 | 23 | 66 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
MTTCELMMAA GSNDNLGLIK GGWTREEDEV LRQMVRHHGD CKWTEIAKSL PSQTGKQCRE 60 RWTNHLYSEI KVPLVICVVL RDPSSLSMQF YTWNFFRLCK TPGNFIPPLE GVAGY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 1e-13 | 18 | 71 | 5 | 58 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in abiotic stress responses (PubMed:17293435, PubMed:19279197). May play a regulatory role in tolerance to salt, cold, and drought stresses (PubMed:17293435). Transcriptional activator that binds specifically to a mitosis-specific activator cis-element 5'-(T/C)C(T/C)AACGG(T/C)(T/C)A-3', found in promoters of cyclin genes such as CYCB1-1 and KNOLLE (AC Q84R43). Positively regulates a subset of G2/M phase-specific genes, including CYCB1-1, CYCB2-1, CYCB2-2, and CDC20.1 in response to cold treatment (PubMed:19279197). {ECO:0000269|PubMed:17293435, ECO:0000269|PubMed:19279197}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KN540497.1_FGP006 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by cold, drought and salt stresses. {ECO:0000269|PubMed:17293435}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP005197 | 1e-135 | AP005197.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0592C06. | |||
| GenBank | AP014963 | 1e-135 | AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015645903.1 | 3e-31 | transcription factor MYB119 | ||||
| Swissprot | Q0JHU7 | 6e-15 | MB3R2_ORYSJ; Transcription factor MYB3R-2 | ||||
| TrEMBL | A0A0P0X4C9 | 3e-70 | A0A0P0X4C9_ORYSJ; Os07g0222501 protein | ||||
| STRING | ONIVA07G05980.1 | 4e-40 | (Oryza nivara) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP22654 | 4 | 6 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G09370.1 | 3e-17 | myb domain protein 3r-3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




